Recombinant Human AP1M2 Protein

Images

 
SDS-Page: Recombinant Human AP1M2 Protein [H00010053-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human AP1M2 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-100 of Human AP1M2

Source: Wheat Germ

Amino Acid Sequence: MSASAVFILDVKGKPLISRNYKGDVAMSKIEHFMPLLVQREEEGALAPLLSHGQVHFLWIKHSNLYLVATTSKNANASLVYSFLYKTIEVFCEYFKELEE

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
AP1M2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AP1M2 Protein

  • Adaptor protein complex AP-1 mu-2 subunit
  • Adaptor-related protein complex 1 mu-2 subunit
  • adaptor-related protein complex 1, mu 2 subunit
  • AP-1 complex subunit mu-2
  • AP1-mu2
  • AP-mu chain family member mu1B
  • Clathrin assembly protein complex 1 medium chain 2
  • clathrin coat assembly protein AP47 2
  • clathrin coat associated protein AP47 2
  • clathrin-associated adaptor medium chain mu2
  • golgi adaptor AP-1 47 kDa protein
  • Golgi adaptor HA1/AP1 adaptin mu-2 subunit
  • HA1 47 kDa subunit 2
  • HSMU1B
  • MU1B
  • MU-1B
  • mu1B-adaptin
  • mu2
  • Mu-adaptin 2

Background

This gene encodes a subunit of the heterotetrameric adaptor-related protein comlex 1 (AP-1), which belongs to the adaptor complexes medium subunits family. This protein is capable of interacting with tyrosine-based sorting signals. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-74359
Species: Hu, Mu, Ch
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
21070002
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
NB110-75039
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-56530
Species: Hu
Applications: WB
NBP2-67861
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89544
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF1443
Species: Mu, Rt
Applications: WB, Simple Western, IHC, ICC
NBP1-89064
Species: Hu
Applications: ICC/IF, IHC, IHC-P
7268-CT
NBP2-65215
Species: Hu
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NBP1-87466
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB100-175
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-49643
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, Flow-IC, KO
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
H00010053-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for AP1M2 Partial Recombinant Protein (H00010053-Q01) (0)

There are no publications for AP1M2 Partial Recombinant Protein (H00010053-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AP1M2 Partial Recombinant Protein (H00010053-Q01) (0)

There are no reviews for AP1M2 Partial Recombinant Protein (H00010053-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AP1M2 Partial Recombinant Protein (H00010053-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for AP1M2 Partial Recombinant Protein (H00010053-Q01)

Discover related pathways, diseases and genes to AP1M2 Partial Recombinant Protein (H00010053-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AP1M2 Partial Recombinant Protein (H00010053-Q01)

Discover more about diseases related to AP1M2 Partial Recombinant Protein (H00010053-Q01).
 

Pathways for AP1M2 Partial Recombinant Protein (H00010053-Q01)

View related products by pathway.

PTMs for AP1M2 Partial Recombinant Protein (H00010053-Q01)

Learn more about PTMs related to AP1M2 Partial Recombinant Protein (H00010053-Q01).

Blogs on AP1M2

There are no specific blogs for AP1M2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

CTLA-4
7268-CT-100
AP1M2 Antibody
NBP1-57035

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AP1M2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AP1M2