We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

Antizyme inhibitor 1 Recombinant Protein Antigen

Images

 
There are currently no images for Antizyme inhibitor 1 Recombinant Protein Antigen (NBP1-82497PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Antizyme inhibitor 1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Antizyme inhibitor 1.

Source: E. coli

Amino Acid Sequence: AKVGVNILTCDNEIELKKIARNHPNAKVLLHIATEDNIGGEEGNMKFGTTLKNCRHLLECAKELDVQIIGVKFHVSSACKESQVYV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AZIN1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-82497.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Antizyme inhibitor 1 Recombinant Protein Antigen

  • antizyme inhibitor 1
  • AZI
  • OAZIMGC691
  • OAZINEC 4.1.1.17
  • ODC1L
  • Ornithine decarboxylase antizyme inhibitorMGC3832

Background

Antizyme inhibitor 1, or AZIN1 for short, consists of a 448 amino acid isoform that is 49 kDa, and is involved in the stabilization of ornithine decarboxylase antizymes, which help to regulate polyamine biosynthesis and homeostasis. Disease research is currently being conducted with AZIN1 and a variety of diseases and disorders to determine the relationship between the two. These diseases include Fanconi's anemia, malaria, liver cirrhosis, prostatitis, Hepatitis C, Hepatitis B, fibrosis, anemia, and prostate cancer. This protein interacts with OAZ2, FANCA, FANCC, OAZ1, and OAZ3 in processes linked to metabolism and regulation of catalytic activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32887
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP1-82493
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-15447
Species: Hu
Applications: WB
H00051686-P01
Species: Hu
Applications: ELISA, AP, PA, WB
NBP3-15005
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP3-04509
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NB100-1607
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IP, WB
233-FB
Species: Hu
Applications: BA
NB110-41404
Species: Bv, Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NB100-78039
Species: Hu, Mu
Applications: CyTOF-ready, ELISA, Flow-CS, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-15447
Species: Hu
Applications: WB
NBP1-82859
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
DY453
Species: Mu
Applications: ELISA
NBP2-32840
Species: Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
NBP1-82497PEP
Species: Hu
Applications: AC

Publications for Antizyme inhibitor 1 Recombinant Protein Antigen (NBP1-82497PEP) (0)

There are no publications for Antizyme inhibitor 1 Recombinant Protein Antigen (NBP1-82497PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Antizyme inhibitor 1 Recombinant Protein Antigen (NBP1-82497PEP) (0)

There are no reviews for Antizyme inhibitor 1 Recombinant Protein Antigen (NBP1-82497PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Antizyme inhibitor 1 Recombinant Protein Antigen (NBP1-82497PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Antizyme inhibitor 1 Products

Research Areas for Antizyme inhibitor 1 Recombinant Protein Antigen (NBP1-82497PEP)

Find related products by research area.

Blogs on Antizyme inhibitor 1

There are no specific blogs for Antizyme inhibitor 1, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Antizyme inhibitor 1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AZIN1