Annexin V Antibody

Western Blot: Annexin V Antibody [H00000308-B01P] - Analysis of ANXA5 expression in human spleen.

Immunocytochemistry/Immunofluorescence: Annexin V Antibody [H00000308-B01P] - Analysis of purified antibody to ANXA5 on HeLa cell. (antibody concentration 10 ug/ml)

Western Blot: Annexin V Antibody [H00000308-B01P] - Analysis of ANXA5 expression in HepG2.

Western Blot: Annexin V Antibody [H00000308-B01P] - Analysis of ANXA5 expression in transfected 293T cell line by ANXA5 polyclonal antibody. Lane 1: ANXA5 transfected lysate(35.2 KDa). Lane 2: Non-transfected lysate.

Product Discontinued

Annexin V Antibody Summary

• Description: Quality control test: Antibody reactive against mammalian transfected lysate.
• Immunogen: ANXA5 (NP_001145.1, 1 a.a. - 320 a.a.) full-length human protein. MAQVLRGTVTDFPGFDERADAETLRKAMKGLGTDEESILTLLTSRSNAQRQEISAAFKTLFGRDLLDDLKSELTGKFEKLIVALMKPSRLYDAYELKHALKGAGTNEKVLTEIIASRTPEELRAIKQVYEEEYGSSLEDDVVGDTSGYYQRMLVVLLQANRDPDAGIDEAQVEQDAQALFQAGELKWGTDEEKFITIFGTRSVSHLRKVFDKYMTISGFQIEETIDRETSGNLEQLLLAVVKSIRSIPAYLAETLYYAMKGAGTDDHTLIRVMVSRSEIDLFNIRKEFRKNFATSLYSMIKGDTSGDYKKALLLLCGEDD
• Specificity: ANXA5 - annexin A5,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: ANXA5
• Purity: Protein A purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Western Blot
• Application Notes: Antibody reactivity against Recombinant Protein with GST tag on ELISA and WB and also on transfected lysate in WB. GST tag alone is used as a negative control. It has been used for IF.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: Protein A purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Annexin V Antibody

• Anchorin CII
• annexin A5
• Annexin V
• annexin-5
• ANX5
• ANXA5
• ANXV
• Calphobindin I
• Endonexin II
• ENX2CBP-I
• Lipocortin V
• PAP-I
• Placental anticoagulant protein 4
• Placental anticoagulant protein I
• PP4
• Thromboplastin inhibitor
• VAC-alpha
• Vascular anticoagulant-alpha

Background

The protein encoded by this gene belongs to the annexin family of calcium-dependent phospholipid binding proteins some of which have been implicated in membrane-related events along exocytotic and endocytotic pathways. Annexin 5 is a phospholipase A2 and protein kinase C inhibitory protein with calcium channel activity and a potential role in cellular signal transduction, inflammation, growth and differentiation. Annexin 5 has also been described as placental anticoagulant protein I, vascular anticoagulant-alpha, endonexin II, lipocortin V, placental protein 4 and anchorin CII. The gene spans 29 kb containing 13 exons, and encodes a single transcript of approximately 1.6 kb and a protein product with a molecular weight of about 35 kDa. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANXA5
• Entrez:
  • 308(Human)
• Uniprot:
  • NP_001145.1(Human)