Annexin A2 Recombinant Protein Antigen

Images

 
There are currently no images for Annexin A2 Recombinant Protein Antigen (NBP2-62614PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Annexin A2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ANXA2.

Source: E. coli

Amino Acid Sequence: MGRQLAGCGDAGKKASFKMSTVHEILCKLSLEGDHSTPPSAYGSVKAYTNFDAERDALNIETAIKTKGVDEVTIVNI

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ANXA2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-62614.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Annexin A2 Recombinant Protein Antigen

  • Annexin A2
  • Annexin II
  • Annexin-2
  • ANX2
  • ANX2L4
  • ANX2L4LPC2
  • ANXA2
  • CAL1H
  • Calpactin I heavy chain
  • calpactin I heavy polypeptide
  • Calpactin-1 heavy chain
  • chromobindin 8
  • Chromobindin-8
  • LIP2
  • LIP2PAP-IV
  • Lipocortin II
  • Lipocortin-2
  • LPC2D
  • LPC2DP36
  • p36
  • PAP-IV
  • Placental anticoagulant protein IV
  • Protein I

Background

The Annexins are a family of structurally similar proteins. Annexins bind to phospholipids and may be involved in regulation of membrane transport, membrane channel activity, and interaction of the cell membrane with the extracellular matrix. Annexin II is a calcium regulated, membrane binding protein whose affinity for calcium is greatly enhanced by anionic phospholipids. It binds two calcium ions with high affinity. This protein functions as an autocrine factor which heightens osteoclast formation and bone resorption. This gene has three pseudogenes located on chromosomes 4, 9 and 10, respectively. Multiple alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF2377
Species: Mu
Applications: IHC, Simple Western, WB
NBP2-55877
Species: Hu
Applications: IHC,  IHC-P
NBP1-57508
Species: Hu
Applications: IHC,  IHC-P, WB
AF3770
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
DTPA00
Species: Hu
Applications: ELISA
NBP2-29373
Species: Hu, Mu, Rt
Applications: Flow-CS, Flow, ICC/IF
AF4146
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP1-90149
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
AF1230
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
M6000B
Species: Mu
Applications: ELISA
NBP3-13279
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF2685
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-87102
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-87103
Species: Hu, Mu
Applications: IHC,  IHC-P, WB
MAB5018
Species: Hu
Applications: IP, WB
H00000902-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, S-ELISA, WB

Publications for Annexin A2 Recombinant Protein Antigen (NBP2-62614PEP) (0)

There are no publications for Annexin A2 Recombinant Protein Antigen (NBP2-62614PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Annexin A2 Recombinant Protein Antigen (NBP2-62614PEP) (0)

There are no reviews for Annexin A2 Recombinant Protein Antigen (NBP2-62614PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Annexin A2 Recombinant Protein Antigen (NBP2-62614PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Annexin A2 Products

Research Areas for Annexin A2 Recombinant Protein Antigen (NBP2-62614PEP)

Find related products by research area.

Blogs on Annexin A2.

Breast cancer stem cells survive chemotherapy through S100A10-ANXA2-SPT6 interaction that epigenetically promotes OCT4-mediated stemness
By Jamshed Arslan, Pharm D, PhDBreast cancer is the most common cancer among women that causes the greatest number of cancer-related deaths worldwide. After radiotherapy or cytotoxic chemotherapy like paclitax...  Read full blog post.

Integrin Beta 1/CD29 - a cell adhesion and cell signaling protein with diverse functions
Integrins are a large family of trasmembrane proteins involved in cell adhesion and form a link between the intracellular cyskeletal proteins and extracellular matrix proteins. Integrins exist as heterodimers consisting of alpha and beta subunits. ...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Annexin A2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ANXA2