Novus Biologicals products are now on bio-techne.com

Annexin A11 Recombinant Protein Antigen

Images

 
There are currently no images for Annexin A11 Protein (NBP1-90160PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Annexin A11 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ANXA11.

Source: E. coli

Amino Acid Sequence: QPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQ

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ANXA11
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-90160.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

For further blocking peptide related information and a protocol, click here.

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Annexin A11 Recombinant Protein Antigen

  • Annexin A11
  • Annexin-11
  • ANX1156-kD
  • ANXA11
  • CAP50
  • CAP-50

Background

Annexin A11 is a member of the annexin family, a group of calcium-dependent phospholipid-binding proteins. Annexins have unique N-terminal domains and conserved C-terminal domains, which contain the calcium-dependent phospholipid-binding sites. The encoded protein is a 56-kD antigen recognized by sera from patients with various autoimmune diseases. Transcript variants encoding the same isoform have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89388
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF3926
Species: Hu, Mu, Rt
Applications: WB
NBP1-90201
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
AF6015
Species: Hu, Mu, Rt
Applications: WB
NBP2-29373
Species: Hu, Mu, Rt
Applications: Flow-CS, Flow, ICC/IF
AF8105
Species: Hu
Applications: IHC, WB
H00000302-M02
Species: Hu, Mu
Applications: ELISA, Flow, ICC/IF, IP, WB
AF7117
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP1-90157
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
H00011155-M06
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IP, KD, WB
NB100-304
Species: Bt, Bv, Ca, Fi, Gt, Hu, Mu, Pm, Rt
Applications: ChIP, ChIP, Flow-IC, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, ISH, KD, KO, WB
NBP2-13304
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-32665
Species: Hu
Applications: IHC, IHC-P, WB
MAB6896
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
AF4146
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-87102
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
AF8171
Species: Hu
Applications: IHC, Simple Western, WB
NBP1-90160PEP
Species: Hu
Applications: AC

Publications for Annexin A11 Protein (NBP1-90160PEP) (0)

There are no publications for Annexin A11 Protein (NBP1-90160PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Annexin A11 Protein (NBP1-90160PEP) (0)

There are no reviews for Annexin A11 Protein (NBP1-90160PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Annexin A11 Protein (NBP1-90160PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Annexin A11 Products

Research Areas for Annexin A11 Protein (NBP1-90160PEP)

Find related products by research area.

Blogs on Annexin A11

There are no specific blogs for Annexin A11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Annexin V Apoptosis Kit [FITC]
NBP2-29373-100Tests

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Annexin A11 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ANXA11