Annexin A11 Antibody

Images

 
Western Blot: Annexin A11 Antibody [H00000311-B01P] - Analysis of ANXA11 expression in human pancreas.
Immunocytochemistry/ Immunofluorescence: Annexin A11 Antibody [H00000311-B01P] - Analysis of purified antibody to ANXA11 on HeLa cell. (antibody concentration 10 ug/ml)
Western Blot: Annexin A11 Antibody [H00000311-B01P] - Analysis of ANXA11 expression in transfected 293T cell line by ANXA11 polyclonal antibody. Lane 1: ANXA11 transfected lysate(55.55 KDa). Lane 2: Non-transfected ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Annexin A11 Antibody Summary

Immunogen
ANXA11 (NP_001148.1, 1 a.a. - 505 a.a.) full-length human protein. MSYPGYPPPPGGYPPAAPGGGPWGGAAYPPPPSMPPIGLDNVATYAGQFNQDYLSGMAANMSGTFGGANMPNLYPGAPGAGYPPVPPGGFGQPPSAQQPVPPYGMYPPPGGNPPSRMPSYPPYPGAPVPGQPMPPPGQQPPGAYPGQPPVTYPGQPPVPLPGQQQPVPSYPGYPGSGTVTPAVPPTQFGSRGTITDAPGFDPLRDAEVLRKAMKGFGTDEQAIIDCLGSRSNKQRQQILLSFKTAYGKDLIKDLKSELSGNFEKTILALMKTPVLFDIYEIKEAIKGVGTDEACLIEILASRSNEHIRELNRAYKAEFKKTLEEAIRSDTSGHFQRLLISLSQGNRDESTNVDMSLAQRDAQELYAAGENRLGTDESKFNAVLCSRSRAHLVAVFNEYQRMTGRDIEKSICREMSGDLEEGMLAVVKCLKNTPAFFAERLNKAMRGAGTKDRTLIRIMVSRSETDLLDIRSEYKRMYGKSLYHDISGDTSGDYRKILLKICGGND
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
ANXA11
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for WB, Functional and IF.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Annexin A11 Antibody

  • Annexin A11
  • Annexin-11
  • ANX1156-kD
  • ANXA11
  • CAP50
  • CAP-50

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89388
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3926
Species: Hu, Mu, Rt
Applications: WB
NB100-65678
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-52414
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, CyTOF-ready, ICC, IF
AF8105
Species: Hu
Applications: WB, IHC
NBP1-31310
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF7117
Species: Hu, Mu
Applications: WB, IHC, ICC
AF4149
Species: Hu, Mu
Applications: WB
H00011155-M06
Species: Hu
Applications: WB, ELISA, ICC/IF
NB100-304
Species: Hu, Mu, Rt, Fi, Gt, Pm
Applications: WB, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP2-13304
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-32665
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB600-1293
Species: Hu, Mu, Rt, Am, Bv, Ca, Ch, Tr
Applications: WB, ICC/IF, IHC, IHC-Fr
AF4146
Species: Hu, Mu, Rt
Applications: WB, IHC
NBP2-45224
Species: Hu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-27972
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
H00000311-B01P
Species: Hu
Applications: WB, ICC/IF

Publications for Annexin A11 Antibody (H00000311-B01P) (0)

There are no publications for Annexin A11 Antibody (H00000311-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Annexin A11 Antibody (H00000311-B01P) (0)

There are no reviews for Annexin A11 Antibody (H00000311-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Annexin A11 Antibody (H00000311-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Annexin A11 Products

Bioinformatics Tool for Annexin A11 Antibody (H00000311-B01P)

Discover related pathways, diseases and genes to Annexin A11 Antibody (H00000311-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Annexin A11 Antibody (H00000311-B01P)

Discover more about diseases related to Annexin A11 Antibody (H00000311-B01P).
 

Pathways for Annexin A11 Antibody (H00000311-B01P)

View related products by pathway.

Research Areas for Annexin A11 Antibody (H00000311-B01P)

Find related products by research area.

Blogs on Annexin A11

There are no specific blogs for Annexin A11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Annexin A11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ANXA11
Entrez
Uniprot