ANKRD37 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ANKRD37 Antibody [NBP2-58724] - Staining of human cell line PC-3 shows localization to nucleus & cytosol.

• Reactivity: Hu, Mu, Rt
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ANKRD37 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ANKRD37 Antibody - BSA Free (NBP2-58724) is a polyclonal antibody validated for use in ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: ASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLV
• Predicted Species: Mouse (91%), Rat (94%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ANKRD37
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ANKRD37 Recombinant Protein Antigen (NBP2-58724PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ANKRD37 Antibody - BSA Free

• ankyrin repeat domain 37
• ankyrin repeat domain-containing protein 37
• hLrp2bp
• low density lipoprotein receptor-related protein binding protein
• Low-density lipoprotein receptor-related protein 2-binding protein
• LPR2BP
• Lrp2bp
• MGC111507

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ANKRD37