![Immunocytochemistry/Immunofluorescence: AMOTL2 Antibody [NBP2-57184] - Staining of human cell line CACO-2 shows localization to centrosome & cell junctions.](http://images.novusbio.com/fullsize2/AMOTL2 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-57184-img0001.jpg "Immunocytochemistry/Immunofluorescence: AMOTL2 Antibody [NBP2-57184] - Staining of human cell line CACO-2 shows localization to centrosome & cell junctions.")
| Reactivity | HuSpecies Glossary |
| Applications | ICC/IF |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PHPAALGHGPLSSLSPPAVEGPVSAQASSATSGSAHLAQMEAVLRENARLQRDNERLQRELESSAEKAGRIEKLESEIQRLSEAHESLTRASSKRE |
| Specificity | Specificity of human AMOTL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | AMOTL2 |
| Purity | Affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS, pH 7.2, containing 40% glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Affinity purified |
Secondary Antibodies |
Isotype Controls |
Diseases for AMOTL2 Antibody (NBP2-57184)Discover more about diseases related to AMOTL2 Antibody (NBP2-57184).
| Pathways for AMOTL2 Antibody (NBP2-57184)View related products by pathway.
|
PTMs for AMOTL2 Antibody (NBP2-57184)Learn more about PTMs related to AMOTL2 Antibody (NBP2-57184).
| Research Areas for AMOTL2 Antibody (NBP2-57184)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | AMOTL2 |
![Immunohistochemistry-Paraffin: AMOT Antibody [NBP2-49513] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize2/AMOT-Antibody-Immunohistochemistry-Paraffin-NBP2-49513-img0003.jpg)
![Immunohistochemistry-Paraffin: AMOT Antibody [NBP2-49513] - Staining of human placenta shows distinct positivity in endothelial cells.](http://images.novusbio.com/fullsize2/AMOT-Antibody-Immunohistochemistry-Paraffin-NBP2-49513-img0002.jpg)
![Immunohistochemistry-Paraffin: AMOT Antibody [NBP2-49513] - Staining in human placenta and pancreas tissues using anti-AMOT antibody. Corresponding AMOT RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/AMOT Antibody-Immunohistochemistry-Paraffin-NBP2-49513-img0004.jpg)
![Western Blot: Angiomotin like 1 Antibody [NBP1-91665] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human cell line A-431](http://images.novusbio.com/fullsize2/Angiomotin-like-1-Antibody-Western-Blot-NBP1-91665-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: Angiomotin like 1 Antibody [NBP1-91665] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & cell junctions.](http://images.novusbio.com/fullsize2/Angiomotin like 1 Antibody-Immunocytochemistry-Immunofluorescence-NBP1-91665-img0007.jpg)
![Immunohistochemistry-Paraffin: Angiomotin like 1 Antibody [NBP1-91665] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.](http://images.novusbio.com/fullsize2/Angiomotin-like-1-Antibody-Immunohistochemistry-Paraffin-NBP1-91665-img0002.jpg)
![Knockout Validated: YAP1 Antibody [NB110-58358] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and YAP1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Rabbit Anti-Human YAP1 Polyclonal Antibody (Catalog # NB110-58358) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for YAP1 at approximately 75 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.](http://images.novusbio.com/fullsize2/YAP1-Antibody-Knockout-Validated-NB110-58358-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: YAP1 Antibody [NB110-58358] - Analysis in Hela cells at a 1:500 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (red) and DAPI (blue), respectively.](http://images.novusbio.com/fullsize2/YAP1-Antibody-Immunocytochemistry-Immunofluorescence-NB110-58358-img0006.jpg)
![Western Blot: YAP1 Antibody [NB110-58358] - Analysis in transfected HEK 293 cell lysate.](http://images.novusbio.com/fullsize2/YAP1-Antibody-Western-Blot-NB110-58358-img0003.jpg)
![Western Blot: TAZ/WWTR1 Antibody [NB110-58359] - WB analysis of Taz in HEK293T cell lysate. Verified customer review from 1DegreeBio.](http://images.novusbio.com/fullsize2/TAZ-WWTR1-Antibody-Western-Blot-NB110-58359-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: TAZ/WWTR1 Antibody [NB110-58359] - Detection of TAZ (Green) in HepG2 cells using NB110-58359. Nuclei (Blue) are counterstained with Hoecsht 33258.](http://images.novusbio.com/fullsize2/TAZ-WWTR1-Antibody-Immunocytochemistry-Immunofluorescence-NB110-58359-img0005.jpg)
![Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NB110-58359] - IHC analysis of formalin fixed paraffin-embedded (FFPE) human kidney using TAZ/WWTR1 antibody at 1:500 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear and cytoplasmic staining was observed. Staining was performed by Histowiz.](http://images.novusbio.com/fullsize2/TAZ-WWTR1-Antibody-Immunohistochemistry-Paraffin-NB110-58359-img0010.jpg)
![HPLC: Ceruloplasmin Native Protein [NBP2-12553]](http://images.novusbio.com/fullsize2/Ceruloplasmin Native Protein-HPLC-NBP2-12553-img0001.jpg)
![Western Blot: MST2/STK3 Antibody (4G10) [NBP1-48017] - MST2 Antibody (4G10) [NBP1-48017] Analysis of extracts (35ug) from 9 different cell lines by using anti-MST2 monoclonal antibody.](http://images.novusbio.com/fullsize2/MST2-STK3-Antibody-(4G10)-Western-Blot-NBP1-48017-img0020.jpg)
![Immunohistochemistry-Paraffin: MST2/STK3 Antibody (4G10) [NBP1-48017] - Staining of paraffin-embedded Ovary tissue using anti-MST2 mouse monoclonal antibody.](http://images.novusbio.com/fullsize2/MST2-STK3-Antibody-(4G10)-Immunohistochemistry-Paraffin-NBP1-48017-img0018.jpg)
![Western Blot: MST2/STK3 Antibody (4G10) [NBP1-48017] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MST2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MST2.](http://images.novusbio.com/fullsize2/MST2-STK3-Antibody-(4G10)-Western-Blot-NBP1-48017-img0019.jpg)
![Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in human kidney.](http://images.novusbio.com/fullsize2/Tafazzin-TAZ-Antibody-(1B10)-Western-Blot-H00006901-M12-img0008.jpg)
![Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in PC-12 (Cat # L012V1).](http://images.novusbio.com/fullsize2/Tafazzin-TAZ-Antibody-(1B10)-Western-Blot-H00006901-M12-img0006.jpg)
![Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in SW-13 (Cat # L005V1).](http://images.novusbio.com/fullsize2/Tafazzin-TAZ-Antibody-(1B10)-Western-Blot-H00006901-M12-img0007.jpg)
![Immunohistochemistry-Paraffin: PATJ Antibody [NB100-1354] - 3.8ug/ml staining of paraffin embedded Human Testis. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.](http://images.novusbio.com/fullsize2/PATJ-Antibody-Immunohistochemistry-Paraffin-NB100-1354-img0002.jpg)
![Western Blot: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp](http://images.novusbio.com/fullsize2/Glutathione-S-Transferase-kappa-1-Antibody-Western-Blot-NBP1-89727-img0004.jpg)
![Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining in human small intestine and pancreas tissues using anti-GSTK1 antibody. Corresponding GSTK1 RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize2/Glutathione-S-Transferase-kappa-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89727-img0007.jpg)
![Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.](http://images.novusbio.com/fullsize2/Glutathione-S-Transferase-kappa-1-Antibody-Immunohistochemistry-Paraffin-NBP1-89727-img0002.jpg)
![Western Blot: Guanylate kinase Antibody (4A8) [NBP2-00594] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Guanylate kinase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Guanylate kinase.](http://images.novusbio.com/fullsize/Guanylate kinase Antibody (4A8)-Western Blot-NBP2-00594-img0004.jpg)
![Immunohistochemistry-Paraffin: Guanylate kinase Antibody (4A8) [NBP2-00594] Staining of paraffin-embedded Human prostate tissue using anti-Guanylate kinase mouse monoclonal antibody.](http://images.novusbio.com/fullsize/Guanylate kinase Antibody (4A8)-Immunohistochemistry-Paraffin-NBP2-00594-img0009.jpg)
![Flow Cytometry: Guanylate kinase Antibody (4A8) [NBP2-00594] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Guanylate kinase antibody, and then analyzed by flow cytometry.](http://images.novusbio.com/fullsize/Guanylate kinase Antibody (4A8)-Flow Cytometry-NBP2-00594-img0003.jpg)
![Western Blot: Flightless I Antibody [NBP1-87926] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.](http://images.novusbio.com/fullsize2/Flightless-I-Antibody-Western-Blot-NBP1-87926-img0007.jpg)
![Immunocytochemistry/Immunofluorescence: Flightless I Antibody [NBP1-87926] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & microtubule organizing center.](http://images.novusbio.com/fullsize2/Flightless-I-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-87926-img0010.jpg)
![Immunohistochemistry-Paraffin: Flightless I Antibody [NBP1-87926] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.](http://images.novusbio.com/fullsize2/Flightless-I-Antibody-Immunohistochemistry-Paraffin-NBP1-87926-img0001.jpg)
![Western Blot: FLI1 Antibody [NBP2-16500] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with FLI1 antibody diluted at 1:1000.](http://images.novusbio.com/fullsize2/FLI1-Antibody-Western-Blot-NBP2-16500-img0014.jpg)
![Immunocytochemistry/Immunofluorescence: FLI1 Antibody [NBP2-16500] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: FLI1 protein stained by FLI1 antibody diluted at 1:500. Blue: Hoechst 33343 staining.](http://images.novusbio.com/fullsize2/FLI1 Antibody-Immunocytochemistry-Immunofluorescence-NBP2-16500-img0003.jpg)
![Immunohistochemistry-Paraffin: FLI1 Antibody [NBP2-16500] - Immunohistochemical analysis of paraffin-embedded SkHep1 xenograft, using antibody at 1:500 dilution.](http://images.novusbio.com/fullsize2/FLI1 Antibody-Immunohistochemistry-Paraffin-NBP2-16500-img0002.jpg)
![Western Blot: MAGI1 Antibody (7B4) [H00009223-M03] - Analysis of MAGI1 expression in PC-12 (Cat # L012V1).](http://images.novusbio.com/fullsize2/MAGI1 Antibody (7B4)-Western Blot-H00009223-M03-img0006.jpg)
![Immunocytochemistry/Immunofluorescence: MAGI1 Antibody (7B4) [H00009223-M03] - Analysis of monoclonal antibody to MAGI1 on HeLa cell. Antibody concentration 10 ug/ml](http://images.novusbio.com/fullsize2/MAGI1-Antibody-(7B4)-Immunocytochemistry-Immunofluorescence-H00009223-M03-img0005.jpg)
![ELISA: MAGI1 Antibody (7B4) [H00009223-M03] - Detection limit for recombinant GST tagged MAGI1 is approximately 0.3ng/ml as a capture antibody.](http://images.novusbio.com/fullsize2/MAGI1-Antibody-(7B4)-ELISA-H00009223-M03-img0003.jpg)
![Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.](http://images.novusbio.com/fullsize2/beta-Catenin-Antibody-(12F7)-Western-Blot-NBP1-54467-img0008.jpg)
![Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).](http://images.novusbio.com/fullsize2/beta-Catenin-Antibody-(12F7)-Immunocytochemistry-Immunofluorescence-NBP1-54467-img0004.jpg)
![Immunohistochemistry-Paraffin: beta-Catenin Antibody (12F7) [NBP1-54467] - IHC analysis of beta- Catenin in mouse intestine using DAB with hematoxylin counterstain.](http://images.novusbio.com/fullsize2/beta-Catenin-Antibody-(12F7)-Immunohistochemistry-Paraffin-NBP1-54467-img0003.jpg)
![Immunohistochemistry-Paraffin: NOLC1 Antibody [NBP1-22981] - Sample: FFPE section of human colon carcinoma. Antibody: Affinity purified rabbit anti- NOPP140 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB](http://images.novusbio.com/fullsize2/NOLC1-Antibody-Immunohistochemistry-Paraffin-NBP1-22981-img0005.jpg)
![Immunoprecipitation: NOLC1 Antibody [NBP1-22981] - Whole cell lysate (1 mg for IP, 20% of IP loaded) from K562 cells. Affinity purified rabbit anti-NOPP140 antibody used for IP at 3 mcg/mg lysate.](http://images.novusbio.com/fullsize2/NOLC1-Antibody-Immunoprecipitation-NBP1-22981-img0002.jpg)
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.](http://images.novusbio.com/images2/Rabbit-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0005.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - FLOW analysis of Mouse CD4+ T cells that were stimulated with anti-CD3/CD28 beads and insulin (1ug/mL) for 5 days in culture media with additional glucose provided. PE conjugated Glut1 antibody stained cells (NB110-39113PE, Orange) were included as positive control which were compared with Rb IgG PE, NBP2-24983 as Isotype Control (Blue) as well as with fluorescence minus one/FMO control (Red) [Image submitted by Verified Customer - see Review for Protocol Details]. Image using the PE form of this antibody.")