AMOTL2 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AMOTL2 Antibody [NBP2-57184] - Staining of human cell line CACO-2 shows localization to centrosome & cell junctions.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AMOTL2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PHPAALGHGPLSSLSPPAVEGPVSAQASSATSGSAHLAQMEAVLRENARLQRDNERLQRELESSAEKAGRIEKLESEIQRLSEAHESLTRASSKRE
Specificity
Specificity of human AMOTL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMOTL2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AMOTL2 Recombinant Protein Antigen (NBP2-57184PEP)

Reactivity Notes

Mouse 84%, Rat 82%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for AMOTL2 Antibody

  • angiomotin like 2
  • KIAA0989
  • LCCPangiomotin-like protein 2
  • Leman coiled-coil protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

H00154796-B01P
Species: Hu, Rt
Applications: WB, ELISA
NBP1-91665
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-58358
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
NBP2-66121
Species: Hu
NB110-58359
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP2-12553
Species: Hu
NBP1-48017
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
H00006901-M12
Species: Hu, Mu, Rt
Applications: WB, ELISA
NB100-1354
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP1-89727
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-00594
Species: Hu
Applications: WB, Flow, IHC, IHC-P
NBP1-87926
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16500
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
H00009223-M03
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
NBP1-54467
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
NBP1-22981
Species: Hu
Applications: IHC, IHC-P, IP

Publications for AMOTL2 Antibody (NBP2-57184) (0)

There are no publications for AMOTL2 Antibody (NBP2-57184).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMOTL2 Antibody (NBP2-57184) (0)

There are no reviews for AMOTL2 Antibody (NBP2-57184). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AMOTL2 Antibody (NBP2-57184) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for AMOTL2 Antibody (NBP2-57184)

Discover related pathways, diseases and genes to AMOTL2 Antibody (NBP2-57184). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMOTL2 Antibody (NBP2-57184)

Discover more about diseases related to AMOTL2 Antibody (NBP2-57184).
 

Pathways for AMOTL2 Antibody (NBP2-57184)

View related products by pathway.

PTMs for AMOTL2 Antibody (NBP2-57184)

Learn more about PTMs related to AMOTL2 Antibody (NBP2-57184).
 

Research Areas for AMOTL2 Antibody (NBP2-57184)

Find related products by research area.

Blogs on AMOTL2

There are no specific blogs for AMOTL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMOTL2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AMOTL2