Home » AMOTL2 » AMOTL2 Antibodies » AMOTL2 Antibody

AMOTL2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: AMOTL2 Antibody [NBP2-57184] - Staining of human cell line CACO-2 shows localization to centrosome & cell junctions.
Immunocytochemistry/ Immunofluorescence: AMOTL2 Antibody [NBP2-57184] - Staining of human cell line CACO-2 shows localization to centrosome & cell junctions.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

AMOTL2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PHPAALGHGPLSSLSPPAVEGPVSAQASSATSGSAHLAQMEAVLRENARLQRDNERLQRELESSAEKAGRIEKLESEIQRLSEAHESLTRASSKRE
Specificity
Specificity of human AMOTL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMOTL2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AMOTL2 Recombinant Protein Antigen (NBP2-57184PEP)

Reactivity Notes

Mouse 84%, Rat 82%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for AMOTL2 Antibody

  • angiomotin like 2
  • KIAA0989
  • LCCPangiomotin-like protein 2
  • Leman coiled-coil protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AMOT Antibody
H00154796-B01P
Western Blot: AMOT Antibody [H00154796-B01P] - Analysis of AMOT expression in transfected 293T cell line by AMOT polyclonal antibody. Lane 1: AMOT transfected lysate(74.25 KDa). Lane 2: Non-transfected lysate.
Western Blot: AMOT Antibody [H00154796-B01P] - analysis of AMOT expression in transfected 293T cell line by AMOT purified MaxPab polyclonal antibody (B01P). Lane 1: AMOT transfected lysate (72.50 KDa). Lane 2: Non-transfected lysate.
Western Blot: AMOT Antibody [H00154796-B01P] - AMOT MaxPab polyclonal antibody. Western Blot analysis of AMOT expression in rat brain.
(4 Publications)
Species: Hu, Rt
Applications: WB, ELISA
Angiomotin like 1
Antibody
NBP1-91665
Western Blot: Angiomotin like 1 Antibody [NBP1-91665] - Lane 1: Marker [kDa] 206, 113, 82, 49, 32, 26, 18Lane 2: Human cell line RT-4Lane 3: Human cell line U-251MG spLane 4: Human cell line A-431
Immunocytochemistry/Immunofluorescence: Angiomotin like 1 Antibody [NBP1-91665] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & cell junctions.
Immunohistochemistry-Paraffin: Angiomotin like 1 Antibody [NBP1-91665] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
YAP1 Antibody
NB110-58358
Knockout Validated: YAP1 Antibody [NB110-58358] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and YAP1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Rabbit Anti-Human YAP1 Polyclonal Antibody (Catalog # NB110-58358) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for YAP1 at approximately 75 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: YAP1 Antibody [NB110-58358] - Analysis in Hela cells at a 1:500 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (red) and DAPI (blue), respectively.
Western Blot: YAP1 Antibody [NB110-58358] - Analysis in transfected HEK 293 cell lysate.
(1 Review)
(25 Publications)
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KO
YY1AP1 Knockout
HeLa Cell Lysate
NBP2-66121
YY1AP1 Knockout HeLa Cell Lysate
Species: Hu
TAZ/WWTR1 Antibody
NB110-58359
Western Blot: TAZ/WWTR1 Antibody [NB110-58359] - WB analysis of Taz in HEK293T cell lysate. Verified customer review from 1DegreeBio.
Immunocytochemistry/Immunofluorescence: TAZ/WWTR1 Antibody [NB110-58359] - Detection of TAZ (Green) in HepG2 cells using NB110-58359. Nuclei (Blue) are counterstained with Hoecsht 33258.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NB110-58359] - IHC analysis of formalin fixed paraffin-embedded (FFPE) human kidney using TAZ/WWTR1 antibody at 1:500 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear and cytoplasmic staining was observed. Staining was performed by Histowiz.
(1 Review)
(8 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
Ceruloplasmin
Native Protein
NBP2-12553
HPLC: Ceruloplasmin Native Protein [NBP2-12553]
Species: Hu
MST2/STK3 Antibody
(OTI4G10)
NBP1-48017
Western Blot: MST2/STK3 Antibody (4G10) [NBP1-48017] - MST2 Antibody (4G10) [NBP1-48017] Analysis of extracts (35ug) from 9 different cell lines by using anti-MST2 monoclonal antibody.
Immunohistochemistry-Paraffin: MST2/STK3 Antibody (4G10) [NBP1-48017] - Staining of paraffin-embedded Ovary tissue using anti-MST2 mouse monoclonal antibody.
Western Blot: MST2/STK3 Antibody (4G10) [NBP1-48017] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MST2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MST2.
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, IHC, IHC-P
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver cancer tissue using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human liver array using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 10 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Lower panel shows a lack of labeling if primary antibodies are omitted and tissue is stained only with secondary antibody followed by incubation with detection reagents. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
Tafazzin/TAZ
Antibody (1B10)
H00006901-M12
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in human kidney.
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in PC-12 (Cat # L012V1).
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in SW-13 (Cat # L005V1).
(1 Review)
(6 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA
PATJ Antibody
NB100-1354
Immunohistochemistry-Paraffin: PATJ Antibody [NB100-1354] - 3.8ug/ml staining of paraffin embedded Human Testis. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(2 Reviews)
(1 Publication)
Species: Hu
Glutathione S
Transferase kappa 1 A ...
NBP1-89727
Western Blot: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Lane 1: Marker [kDa] 229, 112, 84, 48, 32, 27, 17. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining in human small intestine and pancreas tissues using anti-GSTK1 antibody. Corresponding GSTK1 RNA-seq data are presented for the same tissues.
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody [NBP1-89727] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.
(1 Publication)
Species: Hu
Applications: WB, IHC, IHC-P
Guanylate kinase
Antibody (OTI4A8)
NBP2-00594
Western Blot: Guanylate kinase Antibody (4A8) [NBP2-00594] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Guanylate kinase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Guanylate kinase.
Immunohistochemistry-Paraffin: Guanylate kinase Antibody (4A8) [NBP2-00594] Staining of paraffin-embedded Human prostate tissue using anti-Guanylate kinase mouse monoclonal antibody.
Flow Cytometry: Guanylate kinase Antibody (4A8) [NBP2-00594] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Guanylate kinase antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Flightless I
Antibody
NBP1-87926
Western Blot: Flightless I Antibody [NBP1-87926] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: Flightless I Antibody [NBP1-87926] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & microtubule organizing center.
Immunohistochemistry-Paraffin: Flightless I Antibody [NBP1-87926] - Staining of human skeletal muscle shows strong cytoplasmic positivity in myocytes.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
FLI1 Antibody
NBP2-16500
Western Blot: FLI1 Antibody [NBP2-16500] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with FLI1 antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: FLI1 Antibody [NBP2-16500] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: FLI1 protein stained by FLI1 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: FLI1 Antibody [NBP2-16500] - Immunohistochemical analysis of paraffin-embedded SkHep1 xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAGI1 Antibody
(7B4)
H00009223-M03
Western Blot: MAGI1 Antibody (7B4) [H00009223-M03] - Analysis of MAGI1 expression in PC-12 (Cat # L012V1).
Immunocytochemistry/Immunofluorescence: MAGI1 Antibody (7B4) [H00009223-M03] - Analysis of monoclonal antibody to MAGI1 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: MAGI1 Antibody (7B4) [H00009223-M03] - Detection limit for recombinant GST tagged MAGI1 is approximately 0.3ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF
beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
Immunohistochemistry: beta-Catenin Antibody (12F7) [NBP1-54467] - Beta-catening (green) was detected in human skin (psoriasis) using beta-catenin-FITC antibody (1:40) in PBS for 1 hour. Nuclei were stained with Dapi (blue). Image from verified customer review.
(3 Reviews)
(6 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC, IF
NOLC1 Antibody
NBP1-22981
Immunohistochemistry-Paraffin: NOLC1 Antibody [NBP1-22981] - Sample: FFPE section of human colon carcinoma. Antibody: Affinity purified rabbit anti- NOPP140 used at a dilution of 1:1,000 (1ug/ml). Detection: DAB
Immunoprecipitation: NOLC1 Antibody [NBP1-22981] - Whole cell lysate (1 mg for IP, 20% of IP loaded) from K562 cells. Affinity purified rabbit anti-NOPP140 antibody used for IP at 3 mcg/mg lysate.
Species: Hu
Applications: IHC, IHC-P, IP

Publications for AMOTL2 Antibody (NBP2-57184) (0)

There are no publications for AMOTL2 Antibody (NBP2-57184).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMOTL2 Antibody (NBP2-57184) (0)

There are no reviews for AMOTL2 Antibody (NBP2-57184). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AMOTL2 Antibody (NBP2-57184) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for AMOTL2 Antibody (NBP2-57184)

Discover related pathways, diseases and genes to AMOTL2 Antibody (NBP2-57184). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMOTL2 Antibody (NBP2-57184)

Discover more about diseases related to AMOTL2 Antibody (NBP2-57184).
 

Pathways for AMOTL2 Antibody (NBP2-57184)

View related products by pathway.

PTMs for AMOTL2 Antibody (NBP2-57184)

Learn more about PTMs related to AMOTL2 Antibody (NBP2-57184).
 

Research Areas for AMOTL2 Antibody (NBP2-57184)

Find related products by research area.

Blogs on AMOTL2

There are no specific blogs for AMOTL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMOTL2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol AMOTL2