Home » AMOTL2 » AMOTL2 Antibodies » AMOTL2 Antibody

AMOTL2 Antibody

 Submit a Review

Images

 
(
Enlarge)
Immunocytochemistry/Immunofluorescence: AMOTL2 Antibody [NBP2-57184] - Staining of human cell line CACO-2 shows localization to centrosome & cell junctions.
Immunocytochemistry/ Immunofluorescence: AMOTL2 Antibody [NBP2-57184] - Staining of human cell line CACO-2 shows localization to centrosome & cell junctions.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

AMOTL2 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PHPAALGHGPLSSLSPPAVEGPVSAQASSATSGSAHLAQMEAVLRENARLQRDNERLQRELESSAEKAGRIEKLESEIQRLSEAHESLTRASSKRE
Specificity
Specificity of human AMOTL2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AMOTL2
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AMOTL2 Recombinant Protein Antigen (NBP2-57184PEP)

Reactivity Notes

Mouse 84%, Rat 82%

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for AMOTL2 Antibody

  • angiomotin like 2
  • KIAA0989
  • LCCPangiomotin-like protein 2
  • Leman coiled-coil protein

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

AMOT Antibody
NBP2-49513
Immunohistochemistry-Paraffin: AMOT Antibody [NBP2-49513] - Staining of human pancreas shows low expression as expected.
Immunohistochemistry-Paraffin: AMOT Antibody [NBP2-49513] - Staining of human placenta shows distinct positivity in endothelial cells.
Immunohistochemistry-Paraffin: AMOT Antibody [NBP2-49513] - Staining in human placenta and pancreas tissues using anti-AMOT antibody. Corresponding AMOT RNA-seq data are presented for the same tissues.
Species: Hu
Applications: IHC, IHC-P
Angiomotin like 1
Antibody
NBP1-91665
Immunocytochemistry/Immunofluorescence: Angiomotin like 1 Antibody [NBP1-91665] - Staining of human cell line A-431 shows localization to cytosol & cell junctions. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Angiomotin like 1 Antibody [NBP1-91665] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
YAP1 Antibody
NB110-58358
Knockout Validated: YAP1 Antibody [NB110-58358] - Western lane view shows lysates of HeLa human cervical epithelial carcinoma parental cell line and YAP1 knockout (KO) HeLa cell line. A specific band was detected for YAP1 at approximately 81 kDa (as indicated) using 50 ug/mL of Rabbit Anti-YAP1 Polyclonal Antibody (Catalog # NB110-58358). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Knockout Validated: YAP1 Antibody [NB110-58358] - Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and YAP1 knockout (KO) HeLa cell line. PVDF membrane was probed with 1:1000 of Rabbit Anti-Human YAP1 Polyclonal Antibody (Catalog # NB110-58358) followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog #HAF008). Specific band was detected for YAP1 at approximately 75 kDa (as indicated) in the parental HeLa cell line, but is not detectable in the knockout HeLa cell line. This experiment was conducted under reducing conditions.
Immunocytochemistry/Immunofluorescence: YAP1 Antibody [NB110-58358] - Analysis in Hela cells at a 1:500 dilution against Dylight 488 (Green). Alpha tubulin and nuclei were counterstained against Dylight 550 (red) and DAPI (blue), respectively.
(2 Reviews)
(48 Publications)
Species: Hu, Mu, Dr
Applications: WB, Simple Western, ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO
YY1AP1 Antibody
NBP1-81763
Immunohistochemistry-Paraffin: YY1AP1 Antibody [NBP1-81763] Staining of human kidney shows strong cytoplasmic and membranous positivity in tubules.
(3 Publications)
Species: Hu
Applications: WB, IHC, IHC-P
TAZ/WWTR1 Antibody
NB110-58359
Western Blot: TAZ/WWTR1 Antibody [NB110-58359] - Detection of TAZ on HEK 293 cell lysate using NB110-58359.
Immunocytochemistry/Immunofluorescence: TAZ/WWTR1 Antibody [NB110-58359] - Detection of TAZ (Green) in HepG2 cells using NB110-58359. Nuclei (Blue) are counterstained with Hoecsht 33258.
Immunohistochemistry-Paraffin: TAZ/WWTR1 Antibody [NB110-58359] - IHC analysis of formalin fixed paraffin-embedded (FFPE) human kidney using TAZ/WWTR1 antibody at 1:500 on a Bond Rx autostainer (Leica Biosystems). The assay involved 20 minutes of heat induced antigen retrieval (HIER) using 10mM sodium citrate buffer (pH 6.0) and endogenous peroxidase quenching with peroxide block. The sections were incubated with primary antibody for 30 minutes and Bond Polymer Refine Detection (Leica Biosystems) with DAB was used for signal development followed by counterstaining with hematoxylin. Whole slide scanning and capturing of representative images was performed using Aperio AT2 (Leica Biosystems). Nuclear and cytoplasmic staining was observed. Staining was performed by Histowiz.
(1 Review)
(11 Publications)
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP, PLA
Human
Ceruloplasmin ELISA K ...
NBP2-60616
ELISA: Human Ceruloplasmin ELISA Kit (Colorimetric) [NBP2-60616]
Species: Hu
MST2/STK3 Antibody
(OTI4G10)
NBP1-48017
Western Blot: MST2/STK3 Antibody (4G10) [NBP1-48017] - MST2 Antibody (4G10) [NBP1-48017] Analysis of extracts (35ug) from 9 different cell lines by using anti-MST2 monoclonal antibody.
Immunohistochemistry-Paraffin: MST2/STK3 Antibody (4G10) [NBP1-48017] - Staining of paraffin-embedded Ovary tissue using anti-MST2 mouse monoclonal antibody.
Western Blot: MST2/STK3 Antibody (4G10) [NBP1-48017] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY MST2 (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MST2.
Species: Hu, Ca, Pm
Applications: WB, IHC, IHC-P
Src [p Tyr419]
Antibody [Unconjugate
AF2685
Western blot shows lysates of MDA‑MB‑468 human breast cancer cell line and HepG2 human hepatocellular carcinoma cell line untreated (-) or treated (+) with 50 μM pervanadate (PV) for 10 minutes. PVDF membrane was probed with 1 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685), followed by HRP-conjugated Anti-Rabbit IgG Secondary Antibody (Catalog # HAF008). A specific band was detected for Phospho-Src (Y419) at approximately 56 - 61 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Simple Western lane view shows lysates of MBA‑MB‑468 human breast cancer cell line untreated (-) or treated (+) with 50 µM Pervanadate (PV) for 10 minutes, loaded at 0.2 mg/mL. A specific band was detected for Phospho-Src (Y419) at approximately 64 kDa (as indicated) using 10 µg/mL of Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685). This experiment was conducted under reducing conditions and using the 12-230 kDa separation system.
Src phosphorylated at Y419 was detected in immersion fixed paraffin-embedded sections of human colon using Rabbit Anti-Human Phospho-Src (Y419) Antigen Affinity-purified Polyclonal Antibody (Catalog # AF2685) at 15 µg/mL overnight at 4 °C. Tissue was stained using the Anti-Rabbit HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS005) and counterstained with hematoxylin (blue). Specific labeling was localized to the cytoplasm of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
(1 Review)
(5 Publications)
Species: Hu
Applications: WB, Simple Western, IHC
Tafazzin/TAZ
Antibody (1B10)
H00006901-M12
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in human kidney.
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in PC-12 (Cat # L012V1).
Western Blot: Tafazzin/TAZ Antibody (1B10) [H00006901-M12] - Analysis of TAZ expression in SW-13 (Cat # L005V1).
(1 Review)
(5 Publications)
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
PATJ Antibody
NB100-1354
Flow Cytometry: PATJ Antibody [NB100-1354] - Analysis of paraformaldehyde fixed A431 cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (1 ug/mL). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
Immunofluorescence: PATJ Antibody [NB100-1354] - Analysis of paraformaldehyde fixed A431 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL), showing junctional staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10 ug/mL) followed by Alexa Fluor 488 secondary antibody (2 ug/mL).
(1 Publication)
Species: Hu
Applications: Flow, PEP-ELISA, IF
CTLA-4
[Unconjugated]
7268-CT
Recombinant Human CTLA-4 Fc Chimera (Catalog # 7268-CT) inhibits IL-2 secretion by stimulated Jurkat human acute Tcell leukemia cells. The ED50 for this effect is 0.03-0.15 μg/mL whenstimulated with 1 μg/mL Recombinant Human B7‑1/CD80 Fc Chimera (Catalog # 140-B1).
(3 Reviews)
(1 Publication)
Species: Hu
Glutathione S
Transferase kappa 1 A ...
NBP2-80461
Western Blot: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Western blot analysis of GSTK1 on different lysates. Proteins were transferred to a PVDF membrane and blocked with 5% BSA in PBS for 1 hour at room temperature. The primary antibody (1:1000) was used in 5% BSA at room temperature for 2 hours. Goat Anti-Rabbit IgG - HRP Secondary Antibody at 1:5000 dilution was used for 1 hour at room temperature.Positive control:Lane 1: SK-BR-3 cell lysateLane 2: Human skin tissue lysateLane 3: Human placenta tissue lysate
Immunohistochemistry-Paraffin: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Immunohistochemical analysis of paraffin-embedded human pancreas tissue using anti-GSTK1 antibody. The section was pre-treated using heat mediated antigen retrieval with Tris-EDTA buffer (pH 8.0-8.4) for 20 minutes.The tissues were blocked in 5% BSA for 30 minutes at room temperature, washed with ddH2O and PBS, and then probed with the primary antibody (1:50) for 30 minutes at room temperature. The detection was performed using an HRP conjugated compact polymer system. DAB was used as the chromogen. Tissues were counterstained with hematoxylin and mounted with DPX.
Flow Cytometry: Glutathione S Transferase kappa 1 Antibody (JE47-38) [NBP2-80461] - Flow cytometric analysis of GSTK1 was done on SiHa cells. The cells were fixed, permeabilized and stained with the primary antibody (1:100) (red). After incubation of the primary antibody at room temperature for an hour, the cells were stained with a Alexa Fluor 488-conjugated goat anti-rabbit IgG Secondary antibody at 1/500 dilution for 30 minutes.Unlabelled sample was used as a control (cells without incubation with primary antibody; black).
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Guanylate kinase
Antibody (OTI4A8)
NBP2-00594
Western Blot: Guanylate kinase Antibody (4A8) [NBP2-00594] - HEK293T cells were transfected with the pCMV6-ENTRY control (Left lane) or pCMV6-ENTRY Guanylate kinase (Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-Guanylate kinase.
Immunohistochemistry-Paraffin: Guanylate kinase Antibody (4A8) [NBP2-00594] Staining of paraffin-embedded Human prostate tissue using anti-Guanylate kinase mouse monoclonal antibody.
Flow Cytometry: Guanylate kinase Antibody (4A8) [NBP2-00594] - HEK293T cells transfected with either overexpression plasmid (Red) or empty vector control plasmid (Blue) were immunostained by anti-Guanylate kinase antibody, and then analyzed by flow cytometry.
Species: Hu
Applications: WB, Flow, IHC, IHC-P
Flightless I
Antibody
NBP1-87926
Western Blot: Flightless I Antibody [NBP1-87926] - Analysis in mouse cell line NIH-3T3 and rat cell line NBT-II.
Immunocytochemistry/Immunofluorescence: Flightless I Antibody [NBP1-87926] - Staining of human cell line U-2 OS shows localization to nucleoplasm, cytosol & microtubule organizing center.
Immunohistochemistry-Paraffin: Flightless I Antibody [NBP1-87926] - Staining of human testis shows strong cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
FLI1 Antibody
NBP2-16500
Western Blot: FLI1 Antibody [NBP2-16500] - Various whole cell extracts (30 ug) were separated by 10% SDS-PAGE, and the membrane was blotted with FLI1 antibody diluted at 1:1000.
Immunocytochemistry/Immunofluorescence: FLI1 Antibody [NBP2-16500] - HeLa cells were fixed in 4% paraformaldehyde at RT for 15 min. Green: FLI1 protein stained by FLI1 antibody diluted at 1:500. Blue: Hoechst 33343 staining.
Immunohistochemistry-Paraffin: FLI1 Antibody [NBP2-16500] - Immunohistochemical analysis of paraffin-embedded SkHep1 xenograft, using antibody at 1:500 dilution.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAGI1 Antibody
(7B4)
H00009223-M03
Western Blot: MAGI1 Antibody (7B4) [H00009223-M03] - Analysis of MAGI1 expression in PC-12 (Cat # L012V1).
Immunocytochemistry/Immunofluorescence: MAGI1 Antibody (7B4) [H00009223-M03] - Analysis of monoclonal antibody to MAGI1 on HeLa cell. Antibody concentration 10 ug/ml
ELISA: MAGI1 Antibody (7B4) [H00009223-M03] - Detection limit for recombinant GST tagged MAGI1 is approximately 0.3ng/ml as a capture antibody.
(2 Publications)
Species: Hu, Rt, Ca, Ha
Applications: WB, ELISA, ICC/IF, S-ELISA
beta-Catenin
Antibody (12F7)
NBP1-54467
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Total protein from human HepG2 and HeLa cells, rat PC12 cells and mouse 3T3 cells was separated on a 7.5% gel by SDS-PAGE, transferred to PVDF membrane and blocked in 5% non-fat milk in TBST. The membrane was probed with 1.0 ug/ml anti-Beta catenin in 1% non-fat milk in TBST and detected with an anti-mouse HRP secondary antibody using chemiluminescence.
Western Blot: beta-Catenin Antibody (12F7) [NBP1-54467] - Activity of Wnt/beta-catenin pathway in the embryonic chick lung. Western blot analysis of active and total beta-catenin in stage b1, b2 and b3 lungs, and stage 24 limb (as positive control). Control loading was performed using beta-tubulin (55 kDa). Total and active beta-catenin correspond to 92 kDa. Image collected and cropped by CiteAb from the following publication (http://dx.plos.org/10.1371/journal.pone.0112388), licensed under a CC-BY licence.
Immunocytochemistry/Immunofluorescence: beta-Catenin Antibody (12F7) [NBP1-54467] - The beta- Catenin antibody was tested in MCF-7 cells against Dylight 488 (Green). Actin and nuclei were counterstained against Phalloidin 550 (Red) and DAPI (Blue).
(4 Reviews)
(12 Publications)
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
NOLC1 Antibody
NBP1-58200
Western Blot: NOLC1 Antibody [NBP1-58200] - NOLC1 antibody - C-terminal region validated by WB using HepG2 cell lysate at 2.5ug/ml.
Immunocytochemistry/Immunofluorescence: NOLC1 Antibody [NBP1-58200] - Zebrafish kidney, 1:250 Image Submitted By: James Lister Virginia Commonwealth University
Immunohistochemistry-Paraffin: NOLC1 Antibody [NBP1-58200] - Human kidney Tissue, antibody concentration 4-8ug/ml. Cells with positive label: renal corpuscle cells (indicated with arrows) 400X magnification.
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P

Publications for AMOTL2 Antibody (NBP2-57184) (0)

There are no publications for AMOTL2 Antibody (NBP2-57184).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMOTL2 Antibody (NBP2-57184) (0)

There are no reviews for AMOTL2 Antibody (NBP2-57184). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AMOTL2 Antibody (NBP2-57184) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional AMOTL2 Products

Bioinformatics Tool for AMOTL2 Antibody (NBP2-57184)

Discover related pathways, diseases and genes to AMOTL2 Antibody (NBP2-57184). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMOTL2 Antibody (NBP2-57184)

Discover more about diseases related to AMOTL2 Antibody (NBP2-57184).
 

Pathways for AMOTL2 Antibody (NBP2-57184)

View related products by pathway.

PTMs for AMOTL2 Antibody (NBP2-57184)

Learn more about PTMs related to AMOTL2 Antibody (NBP2-57184).
 

Research Areas for AMOTL2 Antibody (NBP2-57184)

Find related products by research area.

Blogs on AMOTL2

There are no specific blogs for AMOTL2, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AMOTL2 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol AMOTL2