Recombinant Human AMOT GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, MA, AP

Order Details

Recombinant Human AMOT GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 361-460 of Human AMOT

Source: Wheat Germ (in vitro)

Amino Acid Sequence: RKEPSKTEQLSCMRPAKSLMSISNAGSGLLSHSSTLTGSPIMEEKRDDKSWKGSLGILLGGDYRAEYVPSTPSPVPPSTPLLSAHSKTGSRDCSTQTERG

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
AMOT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AMOT GST (N-Term) Protein

  • angiomotin p80 isoform
  • angiomotin
  • KIAA1071angiomotin p130 isoform

Background

This gene belongs to the motin family of angiostatin binding proteins characterized by conserved coiled-coil domains and C-terminal PDZ binding motifs. The encoded protein is expressed predominantly in endothelial cells of capillaries as well as larger vessels of the placenta where it may mediate the inhibitory effect of angiostatin on tube formation and the migration of endothelial cells toward growth factors during the formation of new blood vessels. Alternatively spliced transcript variants encoding different isoforms have been described, but their full-length nature has not been completely determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91665
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF226
Species: Hu
Applications: WB
NB110-58358
Species: Ca, Hu, Mu, Rt, Ze
Applications: ChIP, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, KD, KO, Simple Western, WB
NBP1-81763
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-92875
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
DVE00
Species: Hu
Applications: ELISA
NB100-1354
Species: Hu
Applications: Flow, IF, PEP-ELISA
NB110-58359
Species: Hu, Mu, Rt
Applications: ChIP, ChIP, ICC/IF, IHC, IHC-P, IP, PLA, Simple Western, WB
NBP1-87839
Species: Hu
Applications: IHC, IHC-P
NBP1-82455
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-83870
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
H00057449-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NB300-952
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
H00009221-M02
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP2-38206
Species: Hu
Applications: IHC, IHC-P, KD, WB
NBP1-81404
Species: Hu
Applications: ChIP, ICC/IF, IHC, IHC-P, IP, Simple Western, WB
NB600-930
Species: Hu, Rt
Applications: ELISA, WB
NBP2-15939
Species: Hu
Applications: ICC/IF, IHC, IHC-P, IP, WB

Publications for AMOT Partial Recombinant Protein (H00154796-Q01) (0)

There are no publications for AMOT Partial Recombinant Protein (H00154796-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMOT Partial Recombinant Protein (H00154796-Q01) (0)

There are no reviews for AMOT Partial Recombinant Protein (H00154796-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AMOT Partial Recombinant Protein (H00154796-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AMOT Products

Diseases for AMOT Partial Recombinant Protein (H00154796-Q01)

Discover more about diseases related to AMOT Partial Recombinant Protein (H00154796-Q01).
 

Pathways for AMOT Partial Recombinant Protein (H00154796-Q01)

View related products by pathway.

PTMs for AMOT Partial Recombinant Protein (H00154796-Q01)

Learn more about PTMs related to AMOT Partial Recombinant Protein (H00154796-Q01).

Blogs on AMOT

There are no specific blogs for AMOT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AMOT GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AMOT