Recombinant Human AMOT Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AMOT Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 361 - 460 of Human AMOT partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:RKEPSKTEQLSCMRPAKSLMSISNAGSGLLSHSSTLTGSPIMEEKRDDKSWKGSLGILLGGDYRAEYVPSTPSPVPPSTPLLSAHSKTGSRDCSTQTERG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
AMOT
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AMOT Protein

  • angiomotin p80 isoform
  • angiomotin
  • KIAA1071angiomotin p130 isoform

Background

This gene belongs to the motin family of angiostatin binding proteins characterized by conserved coiled-coil domains and C-terminal PDZ binding motifs. The encoded protein is expressed predominantly in endothelial cells of capillaries as well as larger vessels of the placenta where it may mediate the inhibitory effect of angiostatin on tube formation and the migration of endothelial cells toward growth factors during the formation of new blood vessels. Alternatively spliced transcript variants encoding different isoforms have been described, but their full-length nature has not been completely determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-91665
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF226
Species: Hu
Applications: WB
H00010413-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-81763
Species: Hu
Applications: IHC, IHC-P
NBP2-57184
Species: Hu
Applications: ICC/IF
NB100-1354
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NB110-58359
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-P, IP
NBP1-87839
Species: Hu
Applications: IHC, IHC-P
NBP1-82455
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83870
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00057449-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF7979
Species: Hu, Mu, Rt
Applications: WB
H00006901-M12
Species: Hu, Mu, Rt
Applications: WB, ELISA
NBP1-58200
Species: Hu, Ze
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-38206
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81404
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB600-930
Species: Hu, Ba
Applications: WB, ELISA
NBP2-15939
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for AMOT Partial Recombinant Protein (H00154796-Q01) (0)

There are no publications for AMOT Partial Recombinant Protein (H00154796-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMOT Partial Recombinant Protein (H00154796-Q01) (0)

There are no reviews for AMOT Partial Recombinant Protein (H00154796-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AMOT Partial Recombinant Protein (H00154796-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AMOT Products

Bioinformatics Tool for AMOT Partial Recombinant Protein (H00154796-Q01)

Discover related pathways, diseases and genes to AMOT Partial Recombinant Protein (H00154796-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMOT Partial Recombinant Protein (H00154796-Q01)

Discover more about diseases related to AMOT Partial Recombinant Protein (H00154796-Q01).
 

Pathways for AMOT Partial Recombinant Protein (H00154796-Q01)

View related products by pathway.

PTMs for AMOT Partial Recombinant Protein (H00154796-Q01)

Learn more about PTMs related to AMOT Partial Recombinant Protein (H00154796-Q01).

Blogs on AMOT

There are no specific blogs for AMOT, but you can read our latest blog posts.

Customers Who Bought This Also Bought

YAP1 Antibody (2F12)
H00010413-M01
AMOT Antibody
H00154796-B01P
TAZ/WWTR1 Antibody
NB110-58359

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AMOT Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AMOT