Recombinant Human AMID Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human AMID Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1-339 of Human AMID

Source: Wheat Germ

Amino Acid Sequence: MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
AIFM2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.
Theoretical MW
62.92 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AMID Protein

  • AMID
  • apoptosis-inducing factor (AIF)-like mitochondrion-associated inducer of death
  • apoptosis-inducing factor 2
  • Apoptosis-inducing factor homologous mitochondrion-associated inducer of death
  • apoptosis-inducing factor, mitochondrion-associated, 2
  • Apoptosis-inducing factor-like mitochondrion-associated inducer of death
  • DKFZp686L1298
  • FLJ14497
  • p53-responsive gene 3 protein
  • PRG3apoptosis-inducing factor (AIF)-homologous mitochondrion-associated inducer ofdeath
  • RP11-367H5.2

Background

The protein encoded by this gene has significant homology to NADH oxidoreductases and the apoptosis-inducing factor PDCD8/AIF. Overexpression of this gene has been shown to induce apoptosis. The expression of this gene is found to be induced by tumor suppressor protein p53 in colon caner cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1457
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-88573
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP2-01696
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi, ICC
NBP1-22568
Species: Hu
Applications: IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56115
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
NLS689
Species: Hu, Po, Ca, Eq, Mk, Pm
Applications: WB, IHC, IHC-P
MAB2476
Species: Hu
Applications: WB, IHC
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
H00007837-Q01
Species: Hu
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC

Publications for AMID Partial Recombinant Protein (H00084883-Q02) (0)

There are no publications for AMID Partial Recombinant Protein (H00084883-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMID Partial Recombinant Protein (H00084883-Q02) (0)

There are no reviews for AMID Partial Recombinant Protein (H00084883-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AMID Partial Recombinant Protein (H00084883-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AMID Products

Bioinformatics Tool for AMID Partial Recombinant Protein (H00084883-Q02)

Discover related pathways, diseases and genes to AMID Partial Recombinant Protein (H00084883-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMID Partial Recombinant Protein (H00084883-Q02)

Discover more about diseases related to AMID Partial Recombinant Protein (H00084883-Q02).
 

Pathways for AMID Partial Recombinant Protein (H00084883-Q02)

View related products by pathway.

PTMs for AMID Partial Recombinant Protein (H00084883-Q02)

Learn more about PTMs related to AMID Partial Recombinant Protein (H00084883-Q02).
 

Research Areas for AMID Partial Recombinant Protein (H00084883-Q02)

Find related products by research area.

Blogs on AMID

There are no specific blogs for AMID, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FANCD2 Antibody
NB100-182
AMID Antibody
NB200-170

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AMID Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AIFM2