Recombinant Human AMID Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AMID Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 339 of Human AMID partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGSQVSVESGALHVVIVGGGFGGIAAASQLQALNVPFMLVDMKDSFHHNVAALRASVETGFAKKTFISYSVTFKDNFRQGLVVGIDLKNQMVLLQGGEALPFSHLILATGSTGPFPGKFNEVSSQQAAIQAYEDMVRQVQRSRFIVVVGGGSAGVEMAAEIKTEYPEKEVTLIHSQVALADKELLPSVRQEVKEILLRKGVQLLLSERVSNLEELPLNEYREYIKVQTDKGTEVATNLVILCTGIKINSSAYRKAFESRLASSGALRVNEHLQVEGHSNVYAIGDCADVRTPKMAYLAGLHANIAVANIVNSVKQRPLQAYKPGALTFLLSMGRNDGVG

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
AIFM2

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AMID Protein

  • AMID
  • apoptosis-inducing factor (AIF)-like mitochondrion-associated inducer of death
  • apoptosis-inducing factor 2
  • Apoptosis-inducing factor homologous mitochondrion-associated inducer of death
  • apoptosis-inducing factor, mitochondrion-associated, 2
  • Apoptosis-inducing factor-like mitochondrion-associated inducer of death
  • DKFZp686L1298
  • FLJ14497
  • p53-responsive gene 3 protein
  • PRG3apoptosis-inducing factor (AIF)-homologous mitochondrion-associated inducer ofdeath
  • RP11-367H5.2

Background

The protein encoded by this gene has significant homology to NADH oxidoreductases and the apoptosis-inducing factor PDCD8/AIF. Overexpression of this gene has been shown to induce apoptosis. The expression of this gene is found to be induced by tumor suppressor protein p53 in colon caner cells. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

AF1457
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-19928
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-01696
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-15291
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-182
Species: Hu, Mu, Ca, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, RNAi
NBP1-22568
Species: Hu
Applications: IHC-P
NB300-749
Species: Hu, Mu, Rt, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, IP
NB100-56115
Species: Hu, Mu, Rt, Ge
Applications: WB, IHC, IHC-Fr, IHC-P, IP
MAB2476
Species: Hu
Applications: WB, IHC
NB200-109
Species: Hu, Mu
Applications: WB, ChIP, Flow, GS, ICC/IF, IP, CyTOF-ready
H00152503-M01
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NB600-717
Species: Hu, Mu, Rt, Po, Bv, Ch, GP, Ma, Rb, Sh
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P, RI
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
NBP2-07463
Species: Hu
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
H00084883-Q02
Species: Hu
Applications: WB, ELISA, PA

Publications for AMID Partial Recombinant Protein (H00084883-Q02) (0)

There are no publications for AMID Partial Recombinant Protein (H00084883-Q02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AMID Partial Recombinant Protein (H00084883-Q02) (0)

There are no reviews for AMID Partial Recombinant Protein (H00084883-Q02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AMID Partial Recombinant Protein (H00084883-Q02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AMID Products

Bioinformatics Tool for AMID Partial Recombinant Protein (H00084883-Q02)

Discover related pathways, diseases and genes to AMID Partial Recombinant Protein (H00084883-Q02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AMID Partial Recombinant Protein (H00084883-Q02)

Discover more about diseases related to AMID Partial Recombinant Protein (H00084883-Q02).
 

Pathways for AMID Partial Recombinant Protein (H00084883-Q02)

View related products by pathway.

PTMs for AMID Partial Recombinant Protein (H00084883-Q02)

Learn more about PTMs related to AMID Partial Recombinant Protein (H00084883-Q02).
 

Research Areas for AMID Partial Recombinant Protein (H00084883-Q02)

Find related products by research area.

Blogs on AMID

There are no specific blogs for AMID, but you can read our latest blog posts.

Customers Who Bought This Also Bought

FANCD2 Antibody
NB100-182
AMID Antibody
NB200-170

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AMID Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AIFM2