AMFR/gp78 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

AMFR/gp78 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AMFR/gp78
  
  

  Source: E.coli

  Amino Acid Sequence: VQRRIRRHKNYLRVVGNMEARFAVATPEELAVNNDDCAICWDSMQAARKLPCGHLFHNSCLRSWLEQDTSCPTCRMSLNIADNNRVREEHQGENLDENL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: AMFR
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25274It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AMFR/gp78 Recombinant Protein Antigen

• AMF receptor
• AMF receptor, isoform 1
• AMF receptor, isoform 2
• AMFR
• autocrine motility factor receptor
• Autocrine motility factor receptor, isoform 2
• gp78
• RING finger protein 45
• RNF45
• RNF45EC 6.3.2.-

Background

AMFR (Autocrine motility factor receptor, isoform 2) is specific receptor for the autocrine motility factor. AMFR possesses ubiquitin ligase activity and can target both itself and other proteins including CD3D and APOB for proteasomal degradation. AMFR mediates tumor invasion and metastasis. The protein interacts with UBE2G2/UBC7 through a region distinct from the RING finger.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AMFR