Aly Antibody


Western Blot: Aly Antibody [NBP2-56154] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.
Immunocytochemistry/ Immunofluorescence: Aly Antibody [NBP2-56154] - Staining of human cell line U-2 OS shows localization to nuclear speckles.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF

Order Details

Aly Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: GGGRNRPAPYSRPKQLPDKWQHDLFDSGFGGGAGVET
Specificity of human Aly antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.04-0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Aly Recombinant Protein Antigen (NBP2-56154PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for Aly Antibody

  • Ally of AML-1 and LEF-1
  • ALYBEFbZIP enhancing factor
  • bZIP-enhancing factor BEF
  • REF
  • THO complex 4
  • THO complex subunit 4
  • tho4
  • Transcriptional coactivator Aly/REF


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, S-ELISA
Species: Hu, Mu, Ca, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Bv, Dr
Applications: WB, Simple Western, ChIP, ELISA, Flow, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, S-ELISA, Flow-IC
Species: Hu, Mu, Rt
Applications: WB, ELISA, IP
Species: Hu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu
Applications: WB, ICC/IF
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ChIP, ELISA, GS, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, PLA, ChIP, KD
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Hu, Po
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF

Publications for Aly Antibody (NBP2-56154) (0)

There are no publications for Aly Antibody (NBP2-56154).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Aly Antibody (NBP2-56154) (0)

There are no reviews for Aly Antibody (NBP2-56154). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Aly Antibody (NBP2-56154) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional Aly Products

Array NBP2-56154

Bioinformatics Tool for Aly Antibody (NBP2-56154)

Discover related pathways, diseases and genes to Aly Antibody (NBP2-56154). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Aly Antibody (NBP2-56154)

Discover more about diseases related to Aly Antibody (NBP2-56154).

Pathways for Aly Antibody (NBP2-56154)

View related products by pathway.

PTMs for Aly Antibody (NBP2-56154)

Learn more about PTMs related to Aly Antibody (NBP2-56154).

Blogs on Aly

There are no specific blogs for Aly, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our Aly Antibody and receive a gift card or discount.


Gene Symbol ALYREF