We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ALX3 Recombinant Protein Antigen

Images

 
There are currently no images for ALX3 Recombinant Protein Antigen (NBP3-17336PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ALX3 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ALX3

Source: E. coli

Amino Acid Sequence: PAEAEEKTSKAASFPQLPLDCRGGPRDGPSNLQGSPGPCLASLHLPLSPGLPDSMELAKN

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ALX3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17336.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
24 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ALX3 Recombinant Protein Antigen

  • ALX homeobox 3
  • aristaless-like homeobox 3
  • homeobox protein aristaless-like 3
  • MGC138212
  • MGC141988
  • Proline-rich transcription factor ALX3

Background

Aristaless-related genes are a group of paired-related homeobox genes which play a role in regulating vertebrate embryogenesis. The homeodomain transciption factor aristaless-like 3 (ALX3) is expressed in mouse embryos from 8 days of gestation, predominantly in neural crest-derived mesenchyme and in lateral plate mesoderm. Expression analysis of human and mouse tissue reveals predominant ALX3 expression in brain tissue. The Alx3 gene maps to chromosome 1p23-p13 and encodes a 343 amino acid protein. Preferential methylation of Alx3 occurs in advanced-stage neuroblastoma and may repress ALX3 expression. Treatment with the methylation inhibitor 5-aza-2'-deoxycytidine restores ALX3 expression. Alx3 (-) mice lack a phenotype distinct from wild-type mice, however Alx3/Alx4 double mutants demonstrate severe craniofacial abnormalities not present in Alx4 single mutants. Specifically, Alx3/Alx4 double mutant newborn mice have cleft nasal regions in addition to malformation of other neural crest-derived skull structures.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45490
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-88190
Species: Hu
Applications: ChIP-EXO-SEQ
7707-NP
Species: Hu
Applications: BA
NBP1-97308
Species: Ca, Hu, Mu, Rt
Applications: DB, ICC/IF, IHC,  IHC-P, KD, Simple Western, WB
NBP2-48570
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-84476
Species: Hu, Rt
Applications:  IHC-P, WB
NB100-56177
Species: Bv, Hu, Mu, Rt, Ze
Applications: IHC,  IHC-P, IP, WB
NBP2-20034
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-88163
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
MAB7555
Species: Hu
Applications: Simple Western, WB
AF3690
Species: Hu, Mu
Applications: ChIP, ICC, WB
NBP3-47844
Species: Hu, Mu, Rt
Applications: ELISA, IHC, WB
NBP2-20486
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, IP, WB
AF6116
Species: Hu
Applications: ICC, WB
NB100-56155
Species: Hu
Applications: IHC,  IHC-P, IP, WB
423-F8
Species: Hu, Mu
Applications: BA
345-FG
Species: Hu
Applications: BA
NBP1-06067
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
NBP3-17336PEP
Species: Hu
Applications: AC

Publications for ALX3 Recombinant Protein Antigen (NBP3-17336PEP) (0)

There are no publications for ALX3 Recombinant Protein Antigen (NBP3-17336PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALX3 Recombinant Protein Antigen (NBP3-17336PEP) (0)

There are no reviews for ALX3 Recombinant Protein Antigen (NBP3-17336PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ALX3 Recombinant Protein Antigen (NBP3-17336PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ALX3 Products

Array NBP3-17336PEP

Blogs on ALX3

There are no specific blogs for ALX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ALX3 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ALX3