Recombinant Human ALX3 Protein

Images

 
SDS-Page: Recombinant Human ALX3 Protein [H00000257-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ALX3 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 150-249 of Human ALX3

Source: Wheat Germ

Amino Acid Sequence: KSKKRRNRTTFSTFQLEELEKVFQKTHYPDVYAREQLALRTDLTEARVQVWFQNRRAKWRKRERYGKIQEGRNPFTAAYDISVLPRTDSHPQLQNSLWAG

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ALX3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ALX3 Protein

  • ALX homeobox 3
  • aristaless-like homeobox 3
  • homeobox protein aristaless-like 3
  • MGC138212
  • MGC141988
  • Proline-rich transcription factor ALX3

Background

ALX3 - aristaless-like homeobox 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-45490
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00008092-M02
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-62710
Species: Hu
Applications: IHC, IHC-P
NBP1-97308
Species: Hu, Mu, Rt
Applications: WB, Simple Western, DB, ICC/IF, IHC, IHC-P
NBP2-48570
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84476
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-56177
Species: Hu, Mu, Rt, Bv, Ze
Applications: WB, IHC, IHC-P, IP
NBP1-83998
Species: Hu
Applications: IHC, IHC-P
NBP1-88163
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
MAB7555
Species: Hu
Applications: WB, Simple Western
AF3690
Species: Hu, Mu
Applications: WB, ChIP, ICC
H00054766-M07
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-20486
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
AF6116
Species: Hu
Applications: WB, ICC
NB100-56155
Species: Hu
Applications: WB, IHC, IHC-P, IP
NBP2-13816
Species: Hu
Applications: WB, IHC, IHC-P, KD
H00000257-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ALX3 Partial Recombinant Protein (H00000257-Q01) (0)

There are no publications for ALX3 Partial Recombinant Protein (H00000257-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALX3 Partial Recombinant Protein (H00000257-Q01) (0)

There are no reviews for ALX3 Partial Recombinant Protein (H00000257-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALX3 Partial Recombinant Protein (H00000257-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Array H00000257-Q01

Bioinformatics Tool for ALX3 Partial Recombinant Protein (H00000257-Q01)

Discover related pathways, diseases and genes to ALX3 Partial Recombinant Protein (H00000257-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALX3 Partial Recombinant Protein (H00000257-Q01)

Discover more about diseases related to ALX3 Partial Recombinant Protein (H00000257-Q01).
 

Pathways for ALX3 Partial Recombinant Protein (H00000257-Q01)

View related products by pathway.

PTMs for ALX3 Partial Recombinant Protein (H00000257-Q01)

Learn more about PTMs related to ALX3 Partial Recombinant Protein (H00000257-Q01).

Blogs on ALX3

There are no specific blogs for ALX3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ALX3 Antibody
NBP1-80285

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ALX3 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ALX3