AlphaB Crystallin/CRYAB Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

AlphaB Crystallin/CRYAB Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AlphaB Crystallin/CRYAB.
  
  

  Source: E. coli

  Amino Acid Sequence: KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAA

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: CRYAB
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49246.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 23 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AlphaB Crystallin/CRYAB Recombinant Protein Antigen

• alpha B crystallin
• Alpha(B)-crystallin
• AlphaB Crystallin
• alpha-crystallin B chain
• CRYA2
• CRYA2alpha crystallin B chain
• CRYAB
• crystallin, alpha B
• CTPP2
• Heat shock protein beta-5
• heat-shock 20 kD like-protein
• HSPB5
• Renal carcinoma antigen NY-REN-27
• Rosenthal fiber component

Background

Crystallin AB is a member of the small heat shock protein family and expressed in several tissues including brain, kidney cardiac and skeletal muscle. Crystallin AB functions as a molecular chaperone and in intracellular architecture. Crystallin AB has shown to have interactions with CRYAA, CRYGC, CRYBB2, CRYBA1 and HSPB8. Defects in crystalline AB have been linked to cause myopathy myofibrillar type 2, cataract posterior polar type 2, and myopathy myofibrillar fatal infantile hypertonic alpha-B crystallin-related (MFMFIH-CRYAB).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: CRYAB