AlphaB Crystallin/CRYAB Recombinant Protein Antigen

Images

 
There are currently no images for AlphaB Crystallin/CRYAB Recombinant Protein Antigen (NBP2-49246PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

AlphaB Crystallin/CRYAB Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AlphaB Crystallin/CRYAB.

Source: E. coli

Amino Acid Sequence: KYRIPADVDPLTITSSLSSDGVLTVNGPRKQVSGPERTIPITREEKPAVTAA

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CRYAB
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-49246.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
23 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AlphaB Crystallin/CRYAB Recombinant Protein Antigen

  • alpha B crystallin
  • alpha(B)-crystallin
  • AlphaB Crystallin
  • alpha-crystallin B chain
  • CRYA2
  • CRYA2alpha crystallin B chain
  • CRYAB
  • crystallin, alpha B
  • CTPP2
  • Heat shock protein beta-5
  • heat-shock 20 kD like-protein
  • HSPB5
  • Renal carcinoma antigen NY-REN-27
  • Rosenthal fiber component

Background

Crystallin AB is a member of the small heat shock protein family and expressed in several tissues including brain, kidney cardiac and skeletal muscle. Crystallin AB functions as a molecular chaperone and in intracellular architecture. Crystallin AB has shown to have interactions with CRYAA, CRYGC, CRYBB2, CRYBA1 and HSPB8. Defects in crystalline AB have been linked to cause myopathy myofibrillar type 2, cataract posterior polar type 2, and myopathy myofibrillar fatal infantile hypertonic alpha-B crystallin-related (MFMFIH-CRYAB).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-32972
Species: Ch, Pm, Hu, Pm, Mu, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-46354
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
AF3844
Species: Hu, Mu
Applications: IHC
MAB4987
Species: Hu, Mu, Rt
Applications: WB
NB300-141
Species: Bv, Ch, Eq, Gp, Hu, Mu, Po, Rb, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
NBP3-16751
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81696
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-52490
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
H00001421-M03
Species: Hu
Applications: ELISA, S-ELISA, WB
H00001415-M02
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP3-03301
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-87851
Species: Hu
Applications: IHC,  IHC-P
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-15365
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, S-ELISA, WB

Publications for AlphaB Crystallin/CRYAB Recombinant Protein Antigen (NBP2-49246PEP) (0)

There are no publications for AlphaB Crystallin/CRYAB Recombinant Protein Antigen (NBP2-49246PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AlphaB Crystallin/CRYAB Recombinant Protein Antigen (NBP2-49246PEP) (0)

There are no reviews for AlphaB Crystallin/CRYAB Recombinant Protein Antigen (NBP2-49246PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AlphaB Crystallin/CRYAB Recombinant Protein Antigen (NBP2-49246PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AlphaB Crystallin/CRYAB Products

Research Areas for AlphaB Crystallin/CRYAB Recombinant Protein Antigen (NBP2-49246PEP)

Find related products by research area.

Blogs on AlphaB Crystallin/CRYAB

There are no specific blogs for AlphaB Crystallin/CRYAB, but you can read our latest blog posts.

Customers Who Bought This Also Bought

GFAP Antibody
NB300-141

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AlphaB Crystallin/CRYAB Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CRYAB