We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

alpha-Aminoadipate Aminotransferase Recombinant Protein Antigen

Images

 
There are currently no images for alpha-Aminoadipate Aminotransferase Protein (NBP1-89627PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

alpha-Aminoadipate Aminotransferase Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AADAT.

Source: E. coli

Amino Acid Sequence: LSWLKQLQIKLHNPPTIHYPPSQGQMDLCVTSGSQQGLCKVFEMIINPGDNVLLDEPAYSGTLQSLHPLGCNIINVASDESGIVPD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AADAT
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-89627.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for alpha-Aminoadipate Aminotransferase Recombinant Protein Antigen

  • AADAT
  • alphaAminoadipate Aminotransferase
  • alpha-Aminoadipate Aminotransferase
  • aminoadipate aminotransferase
  • EC 2.6.1.39,2-aminoadipate aminotransferase
  • EC 2.6.1.7,2-aminoadipate transaminase
  • KAT/AadAT
  • KAT2
  • KAT2mitochondrial
  • Kynurenine aminotransferase II
  • Kynurenine--oxoglutarate aminotransferase II
  • Kynurenine--oxoglutarate transaminase II
  • L kynurenine/alpha aminoadipate aminotransferase

Background

Aminoadipate aminotransferase (AADAT) is a protein that is highly similar to mouse and rat kynurenine aminotransferase II. The rat protein is a homodimer with two transaminase activities. One activity is the transamination of alpha-aminoadipic acid, a final step in the saccaropine pathway which is the major pathway for L-lysine catabolism. The other activity involves the transamination of kynurenine to produce kynurenine acid, the precursor of kynurenic acid which has neuroprotective properties. Two alternative transcripts encoding the same isoform have been identified, however, additional alternative transcripts and isoforms may exist.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-01383
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
H00050848-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, PLA, S-ELISA, WB
NBP1-87835
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
NBP1-86335
Species: Hu
Applications: IHC,  IHC-P
H00008086-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, WB
NBP3-32740
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, IP, WB
NBP2-27461
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, PEP-ELISA, WB
NBP1-59322
Species: Hu
Applications: IHC,  IHC-P, WB
NBP1-87781
Species: Hu
Applications: IHC,  IHC-P
MAB7389
Species: Mu
Applications: IHC, WB
AF23151
Species: Hu, Mu, Rt
Applications: IHC, Simple Western, WB
NBP2-48549
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB
NBP1-85482
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-13795
Species: Hu
Applications: IHC,  IHC-P

Publications for alpha-Aminoadipate Aminotransferase Protein (NBP1-89627PEP) (0)

There are no publications for alpha-Aminoadipate Aminotransferase Protein (NBP1-89627PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for alpha-Aminoadipate Aminotransferase Protein (NBP1-89627PEP) (0)

There are no reviews for alpha-Aminoadipate Aminotransferase Protein (NBP1-89627PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for alpha-Aminoadipate Aminotransferase Protein (NBP1-89627PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional alpha-Aminoadipate Aminotransferase Products

Research Areas for alpha-Aminoadipate Aminotransferase Protein (NBP1-89627PEP)

Find related products by research area.

Blogs on alpha-Aminoadipate Aminotransferase

There are no specific blogs for alpha-Aminoadipate Aminotransferase, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our alpha-Aminoadipate Aminotransferase Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AADAT