alpha-1D Adrenergic R/ADRA1D Antibody - Azide and BSA Free

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: Azide and BSA Free

alpha-1D Adrenergic R/ADRA1D Antibody - Azide and BSA Free Summary

• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 450-550 of human ADRA1D (NP_000669.1). APSSGDAPPGAPLALTALPDPDPEPPGTPEMQAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADRA1D
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500-1:2000
• Theoretical MW: 60 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for alpha-1D Adrenergic R/ADRA1D Antibody - Azide and BSA Free

• a-1D AdrenergicR
• ADRA1
• ADRA1ADAR
• ADRA1D
• ADRA1R
• adrenergic, alpha -1D-, receptor
• adrenergic, alpha-1A-, receptor
• adrenergic, alpha-1D-, receptor
• ALPHA1
• Alpha-1A adrenergic receptor
• alpha-1D Adrenergic R
• alpha-1D adrenergic receptor
• alpha1D AdrenergicR
• Alpha-1D adrenoceptor
• Alpha-1D adrenoreceptor
• alpha-1D-adrenergic receptor
• Alpha-adrenergic receptor 1a
• DAR
• dJ779E11.2

Background

The alpha 1d-adrenoceptor is an Adrenergic Receptor that causes the contraction of smooth muscle and increases intracellular calcium. Expression of the alpha 1d-adrenoceptor has been reported primarily in smooth muscle of arterioles, eye, gut, skin, vein, as well as in other cell types (e.g. salivary gland). Adrenoceptors are also expressed in hippocampus, cerebral cortex, and brainstem. Caution: The name ADRA1A has been used to describe both the alpha 1d adrenoceptor (human chromosome 20) and the alpha 1c adrenoceptor (human chromosome 8), and the alpha 1c adrenoceptor is also known as alpha 1a adrenoceptor.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov

Bioinformatics

• Gene Symbol: ADRA1D