alpha-1D Adrenergic R/ADRA1D Antibody - Azide and BSA Free Summary
Immunogen |
A synthetic peptide corresponding to a sequence within amino acids 450-550 of human ADRA1D (NP_000669.1). APSSGDAPPGAPLALTALPDPDPEPPGTPEMQAPVASRRKPPSAFREWRLLGPFRRPTTQLRAKVSSLSHKIRAGGAQRAEAACAQRSEVEAVSLGVPHEV |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
ADRA1D |
Purity |
Affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 1:500-1:2000
|
Theoretical MW |
60 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
Storage |
Store at -20C. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.3), 50% glycerol |
Preservative |
0.01% Thimerosal |
Purity |
Affinity purified |
Alternate Names for alpha-1D Adrenergic R/ADRA1D Antibody - Azide and BSA Free
Background
The alpha 1d-adrenoceptor is an Adrenergic Receptor that causes the contraction of smooth muscle and increases intracellular calcium. Expression of the alpha 1d-adrenoceptor has been reported primarily in smooth muscle of arterioles, eye, gut, skin, vein, as well as in other cell types (e.g. salivary gland). Adrenoceptors are also expressed in hippocampus, cerebral cortex, and brainstem. Caution: The name ADRA1A has been used to describe both the alpha 1d adrenoceptor (human chromosome 20) and the alpha 1c adrenoceptor (human chromosome 8), and the alpha 1c adrenoceptor is also known as alpha 1a adrenoceptor.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Bv, Ca, Ha, Hu, Pm, Mu, Pm, Rt
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
Species: Ca, Hu, Mu, Pm, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC, IHC, Neut, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: Func, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Species: Mu
Applications: ELISA
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu
Applications: WB
⚠ WARNING: This product can expose you to chemicals including Methotrexate, which is known to the State of California to cause reproductive toxicity with developmental effects. For more information, go to www.P65Warnings.ca.gov
Publications for alpha-1D Adrenergic R/ADRA1D Antibody (NBP2-92314) (0)
There are no publications for alpha-1D Adrenergic R/ADRA1D Antibody (NBP2-92314).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for alpha-1D Adrenergic R/ADRA1D Antibody (NBP2-92314) (0)
There are no reviews for alpha-1D Adrenergic R/ADRA1D Antibody (NBP2-92314).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for alpha-1D Adrenergic R/ADRA1D Antibody (NBP2-92314) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional alpha-1D Adrenergic R/ADRA1D Products
Research Areas for alpha-1D Adrenergic R/ADRA1D Antibody (NBP2-92314)
Find related products by research area.
|
Blogs on alpha-1D Adrenergic R/ADRA1D