ALOX12B Antibody (3G12) - Azide and BSA Free

• Reactivity: Hu
• Applications: ELISA
• Clone: 3G12
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

ALOX12B Antibody (3G12) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: ALOX12B (NP_001130, 171 a.a. ~ 261 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NPNRPEWNGYIPGFPILINFKATKFLNLNLRYSFLKTASFFVRLGPMALAFKVRGLLDCKHSWKRLKDIRKIFPGKKSVVSEYVAEHWAED
• Specificity: ALOX12B - arachidonate 12-lipoxygenase, 12R type (3G12)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ALOX12B
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
• Application Notes: It has been used for ELISA.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ALOX12B Antibody (3G12) - Azide and BSA Free

• 12R-LOXEC 1.13.11.-
• arachidonate 12-lipoxygenase, 12R type
• arachidonate 12-lipoxygenase, 12R-type
• EC 1.13.11.33,12R-lipoxygenase
• Epidermis-type lipoxygenase 12

Background

This gene encodes an enzyme involved in the converstion of arachidonic acid to 12R-hydroxyeicosatetraenoic acid. Mutations in this gene are associated with nonbullous congenital ichthyosiform erythroderma. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ALOX12B
• Entrez:
  • 242(Human)
• Uniprot:
  • NP_001130(Human)