Alkaline Ceramidase 2 Antibody - BSA Free

Western Blot: Alkaline Ceramidase 2 Antibody [NBP3-10690] - Western blot analysis of Alkaline Ceramidase 2 in Fetal Lung as a positive control. Antibody dilution at 1.0 ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Alkaline Ceramidase 2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human Alkaline Ceramidase 2 (NP_001010887). Peptide sequence DELAVLWVLMCALAMWFPRRYLPKIFRNDRGRFKVVVSVLSAVTTCLAFV
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ACER2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 31 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Alkaline Ceramidase 2 Antibody - BSA Free

• Acylsphingosine deacylase 3-like
• Alkaline CDase 2
• alkaline ceramidase 2
• AlkCDase 2
• ALKCDase2
• ASAH3L
• ceramide hydrolase
• EC 3.5.1.23
• FLJ41587
• haCER2
• N-acylsphingosine amidohydrolase 3-like

Background

Hydrolyzes the sphingolipid ceramide into sphingosine and free fatty acid. Regulates the maturation ofintegrin beta-1 (ITGB1) by controlling the generation of sphingosine in the Golgi complex. Inhibits cell adhesion byreducing the level of ITGB1 in the cell surface. May have a role in cell proliferation and apoptosis that seems todepend on the balance between sphingosine and sphingosine-1-phosphate

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ACER2