ALG8 Antibody (2E10)

Sandwich ELISA: ALG8 Antibody (2E10) [H00079053-M01] - Detection limit for recombinant GST tagged ALG8 is approximately 0.3ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 2E10
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated

ALG8 Antibody (2E10) Summary

• Immunogen: ALG8 (NP_076984, 260 a.a. ~ 334 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NQLPQVFSRLFPFKRGLCHAYWAPNFWALYNALDKVLSVIGLKLKFLDPNNIPKASMTSGLVQQFQHTVLPSVTP
• Localization: Endoplasmic reticulum membrane; Multi-pass membrane protein
• Specificity: ALG8 - asparagine-linked glycosylation 8 homolog (yeast, alpha-1,3-glucosyltransferase)
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: ALG8
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ALG8 Antibody (2E10)

• alpha-1,3-glucosyltransferase)
• asparagine-linked glycosylation 8 homolog (S. cerevisiae
• asparagine-linked glycosylation 8 homolog (yeast
• asparagine-linked glycosylation 8, alpha-1,3-glucosyltransferase homolog (S.cerevisiae)
• Asparagine-linked glycosylation protein 8 homolog
• CDG1H
• dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase
• Dolichyl-P-Glc:Glc1Man9GlcNAc2-PP-dolichyl glucosyltransferase
• dolichyl-P-glucose:Glc1Man9GlcNAc2-PP-dolichyl-alpha-1,3-glucosyltransferase
• EC 2.4.1
• EC 2.4.1.-
• HUSSY-02
• MGC2840
• probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase

Background

This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the second glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation of proteins. Mutations in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ih). Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ALG8
• Entrez:
  • 79053(Human)
• OMIM:
  • 608103(Human)
• Uniprot:
  • NP_076984(Human)