ALG8 Antibody (2E10)

Images

 
Sandwich ELISA: ALG8 Antibody (2E10) [H00079053-M01] - Detection limit for recombinant GST tagged ALG8 is approximately 0.3ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, S-ELISA
Clone
2E10
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ALG8 Antibody (2E10) Summary

Immunogen
ALG8 (NP_076984, 260 a.a. ~ 334 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. NQLPQVFSRLFPFKRGLCHAYWAPNFWALYNALDKVLSVIGLKLKFLDPNNIPKASMTSGLVQQFQHTVLPSVTP
Localization
Endoplasmic reticulum membrane; Multi-pass membrane protein
Specificity
ALG8 - asparagine-linked glycosylation 8 homolog (yeast, alpha-1,3-glucosyltransferase)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ALG8
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Human. Other species not tested.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ALG8 Antibody (2E10)

  • alpha-1,3-glucosyltransferase)
  • asparagine-linked glycosylation 8 homolog (S. cerevisiae
  • asparagine-linked glycosylation 8 homolog (yeast
  • asparagine-linked glycosylation 8, alpha-1,3-glucosyltransferase homolog (S.cerevisiae)
  • Asparagine-linked glycosylation protein 8 homolog
  • CDG1H
  • dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase
  • Dolichyl-P-Glc:Glc1Man9GlcNAc2-PP-dolichyl glucosyltransferase
  • dolichyl-P-glucose:Glc1Man9GlcNAc2-PP-dolichyl-alpha-1,3-glucosyltransferase
  • EC 2.4.1
  • EC 2.4.1.-
  • HUSSY-02
  • MGC2840
  • probable dolichyl pyrophosphate Glc1Man9GlcNAc2 alpha-1,3-glucosyltransferase

Background

This gene encodes a member of the ALG6/ALG8 glucosyltransferase family. The encoded protein catalyzes the addition of the second glucose residue to the lipid-linked oligosaccharide precursor for N-linked glycosylation of proteins. Mutations in this gene have been associated with congenital disorder of glycosylation type Ih (CDG-Ih). Alternatively spliced transcript variants encoding different isoforms have been identified.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-62494
Species: Hu
Applications: WB
NBP2-14281
Species: Hu
Applications: IHC, IHC-P, WB
NBP1-05034
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP2-92371
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-81923
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
NBP1-81290
Species: Hu
Applications: ICC/IF, IHC, IHC-P
AF6015
Species: Hu, Mu, Rt
Applications: WB
NBP2-01734
Species: Hu
Applications: IHC, IHC-P, WB
H00007138-B01P
Species: Hu, In
Applications: WB
AF3357
Species: Mu
Applications: WB
NBP1-90191
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00342184-M07
Species: Hu
Applications: ELISA, ICC/IF, WB
NBP1-85856
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NB100-695
Species: Fi, Hu, Mu, Rt
Applications: ELISA, IHC, KD, WB
DPI00
Species: Hu
Applications: ELISA
MAB5125
Species: Hu, Mu, Rt
Applications: IHC, WB
NB100-464
Species: Hu, Mu
Applications: IHC, IHC-P, IP, WB
NBP2-47123
Species: Hu
Applications: IHC, IHC-P, WB

Publications for ALG8 Antibody (H00079053-M01) (0)

There are no publications for ALG8 Antibody (H00079053-M01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG8 Antibody (H00079053-M01) (0)

There are no reviews for ALG8 Antibody (H00079053-M01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALG8 Antibody (H00079053-M01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALG8 Products

Array H00079053-M01

Bioinformatics Tool for ALG8 Antibody (H00079053-M01)

Discover related pathways, diseases and genes to ALG8 Antibody (H00079053-M01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALG8 Antibody (H00079053-M01)

Discover more about diseases related to ALG8 Antibody (H00079053-M01).
 

Pathways for ALG8 Antibody (H00079053-M01)

View related products by pathway.

PTMs for ALG8 Antibody (H00079053-M01)

Learn more about PTMs related to ALG8 Antibody (H00079053-M01).

Blogs on ALG8

There are no specific blogs for ALG8, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALG8 Antibody (2E10) and receive a gift card or discount.

Bioinformatics

Gene Symbol ALG8
Entrez
OMIM
Uniprot