Recombinant Human ALG5 Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ALG5 Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 232-324 of Human ALG5

Source: Wheat Germ

Amino Acid Sequence: RDTQCGFKLFTREAASRTFSSLHVERWAFDVELLYIAQFFKIPIAEIAVNWTEIEGSKLVPFWSWLQMGKDLLFIRLRYLTGAWRLEQTRKMN

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ALG5
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
35.97 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ALG5 Protein

  • Alg5, S. cerevisiae, homolog of
  • asparagine-linked glycosylation 5 homolog (S. cerevisiae, dolichyl-phosphatebeta-glucosyltransferase)
  • asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphatebeta-glucosyltransferase)
  • asparagine-linked glycosylation 5, dolichyl-phosphate beta-glucosyltransferasehomolog (S. cerevisiae)
  • Asparagine-linked glycosylation protein 5 homolog
  • bA421P11.2
  • dolichyl phosphate glucosyltransferase
  • dolichyl-phosphate beta-glucosyltransferase
  • dolP-glucosyltransferase
  • EC 2.4.1
  • EC 2.4.1.117
  • RP11-421P11.2

Background

ALG5 - asparagine-linked glycosylation 5 homolog (yeast, dolichyl-phosphate beta-glucosyltransferase)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-62494
Species: Hu
Applications: WB
NBP1-05034
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-47550
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14281
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52983
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-91577
Species: Hu
Applications: WB, IHC, IHC-P
NB600-1342
Species: Hu, Mu, Rt, Bv
Applications: WB, IA, IHC, IHC-Fr, IHC-P, IP
NBP1-89728
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80835
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-19741
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89111
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NB100-56503
Species: Hu, Mu, Rt, Po, Ca, Dr, Eq, Ma, Rb
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, Flow-IC
NBP1-85715
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88856
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
46780002
Species: Hu
Applications: ELISA
H00029880-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for ALG5 Partial Recombinant Protein (H00029880-Q01) (0)

There are no publications for ALG5 Partial Recombinant Protein (H00029880-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALG5 Partial Recombinant Protein (H00029880-Q01) (0)

There are no reviews for ALG5 Partial Recombinant Protein (H00029880-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ALG5 Partial Recombinant Protein (H00029880-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for ALG5 Partial Recombinant Protein (H00029880-Q01)

Discover related pathways, diseases and genes to ALG5 Partial Recombinant Protein (H00029880-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALG5 Partial Recombinant Protein (H00029880-Q01)

Discover more about diseases related to ALG5 Partial Recombinant Protein (H00029880-Q01).
 

Pathways for ALG5 Partial Recombinant Protein (H00029880-Q01)

View related products by pathway.

PTMs for ALG5 Partial Recombinant Protein (H00029880-Q01)

Learn more about PTMs related to ALG5 Partial Recombinant Protein (H00029880-Q01).

Blogs on ALG5

There are no specific blogs for ALG5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

ALG5 Antibody
NBP1-88767

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ALG5 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ALG5