ALDH2 Antibody (4C11)

Images

 
ELISA: ALDH2 Antibody (4C11) [H00000217-M17] - Detection limit for recombinant GST tagged ALDH2 is approximately 1ng/ml as a capture antibody.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ELISA
Clone
4C11
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

ALDH2 Antibody (4C11) Summary

Immunogen
ALDH2 (AAH02967, 408 a.a. - 517 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGLQAYTEVKTVTVKVPQKNS
Specificity
ALDH2 - aldehyde dehydrogenase 2 family (mitochondrial) (4C11)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
ALDH2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
Application Notes
Antibody reactivity against recombinant protein with GST tag on ELISA. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ALDH2 Antibody (4C11)

  • acetaldehyde dehydrogenase 2
  • aldehyde dehydrogenase 2 family (mitochondrial)
  • aldehyde dehydrogenase, mitochondrial
  • ALDH class 2
  • ALDH-E2
  • ALDHI
  • ALDM
  • EC 1.2.1
  • EC 1.2.1.3
  • liver mitochondrial ALDH
  • MGC1806
  • nucleus-encoded mitochondrial aldehyde dehydrogenase 2

Background

This protein belongs to the aldehyde dehydrogenase family of proteins. Aldehyde dehydrogenase is the second enzyme of the major oxidative pathway of alcohol metabolism. Two major liver isoforms of this enzyme, cytosolic and mitochondrial, can be distinguished by their electrophoretic mobilities, kinetic properties, and subcellular localizations. Most Caucasians have two major isozymes, while approximately 50% of Orientals have only the cytosolic isozyme, missing the mitochondrial isozyme. A remarkably higher frequency of acute alcohol intoxication among Orientals than among Caucasians could be related to the absence of the mitochondrial isozyme. This gene encodes a mitochondrial isoform, which has a low Km for acetaldehydes, and is localized in mitochondrial matrix. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-00649
Species: Hu, Rt, Ca
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-02164
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NB100-65214
Species: Hu, Mu, Rt, Ma
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-85367
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00000126-D01P
Species: Hu, Mu
Applications: WB
AF5869
Species: Hu, Mu
Applications: WB, Simple Western, IHC, IP, ICC
NB600-326
Species: NA
Applications: WB, Simple Western, ELISA, ICC/IF, IHC, IHC-P, IP
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-02483
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF1936
Species: Hu
Applications: WB, IP
NBP1-32733
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P, IP
NB100-74398
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-37607
Species: Hu, Rt
Applications: WB, ELISA, IHC
NBP1-32569
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ALDH2 Antibody (H00000217-M17) (0)

There are no publications for ALDH2 Antibody (H00000217-M17).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH2 Antibody (H00000217-M17) (0)

There are no reviews for ALDH2 Antibody (H00000217-M17). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ALDH2 Antibody (H00000217-M17) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ALDH2 Products

Bioinformatics Tool for ALDH2 Antibody (H00000217-M17)

Discover related pathways, diseases and genes to ALDH2 Antibody (H00000217-M17). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ALDH2 Antibody (H00000217-M17)

Discover more about diseases related to ALDH2 Antibody (H00000217-M17).
 

Pathways for ALDH2 Antibody (H00000217-M17)

View related products by pathway.

PTMs for ALDH2 Antibody (H00000217-M17)

Learn more about PTMs related to ALDH2 Antibody (H00000217-M17).

Blogs on ALDH2

There are no specific blogs for ALDH2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ALDH2 Antibody (4C11) and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH2
Entrez
Uniprot