We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ALDH16A1 Recombinant Protein Antigen

Images

 
There are currently no images for ALDH16A1 Protein (NBP2-31774PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ALDH16A1 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ALDH16A1.

Source: E. coli

Amino Acid Sequence: ESVWDEAMRRLQERMGRLRSGRGLDGAVDMGARGAAACDLVQRFVREAQSQGAQVFQAGDVPSERPFYPPTLVSNLPPASPCAQVE

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ALDH16A1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-31774.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
27 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ALDH16A1 Recombinant Protein Antigen

  • aldehyde dehydrogenase 16 family, member A1
  • aldehyde dehydrogenase family 16 member A1
  • MGC10204

Background

The ALDH16A1 gene encodes a member of the aldehyde dehydrogenases superfamily. The family members act on aldehyde substratesand use nicotinamide adenine dinucleotide phosphate (NADP) as a cofactor. This gene is conserved in chimpanzee, dog,cow, mouse, rat, and ze

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-56164
Species: Hu
Applications: ICC/IF, WB
NB110-78626
Species: Hu, Mu
Applications: ChIP, Flow, ICC/IF (-), IHC,  IHC-P, IP, WB
NBP2-47940
Species: Hu
Applications: CyTOF-ready, Flow, ICC/IF, IF, IHC,  IHC-P, Simple Western, WB
NBP1-47492
Species: Pm, Hu
Applications: ChIP, ELISA, ICC/IF, IHC,  IHC-P, WB
NBP2-15339
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
H00005688-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, IP, S-ELISA, WB
NBP2-27163
Species: Bv, Ca, Eq, Hu, Mu, Pm
Applications: Flow, WB
NBP1-87158
Species: Hu
Applications: IHC,  IHC-P, Simple Western, WB
NBP2-01488
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-34294
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P
NBP2-48693
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP2-31774PEP
Species: Hu
Applications: AC

Publications for ALDH16A1 Protein (NBP2-31774PEP) (0)

There are no publications for ALDH16A1 Protein (NBP2-31774PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ALDH16A1 Protein (NBP2-31774PEP) (0)

There are no reviews for ALDH16A1 Protein (NBP2-31774PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ALDH16A1 Protein (NBP2-31774PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ALDH16A1 Products

Research Areas for ALDH16A1 Protein (NBP2-31774PEP)

Find related products by research area.

Blogs on ALDH16A1

There are no specific blogs for ALDH16A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ALDH16A1 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ALDH16A1