Alanyl tRNA synthetase Antibody - BSA Free

Western Blot: Alanyl tRNA synthetase Antibody [NBP1-57136] - Sample Type: Jurkat Antibody Dilution: 1.0 ug/ml AARS is supported by BioGPS gene expression data to be expressed in Jurkat

Immunohistochemistry: Alanyl tRNA synthetase Antibody [NBP1-57136] - Formalin Fixed Paraffin Embedded Tissue: Human Pineal Tissue Observed Staining: Cytoplasmic in cell processes of pinealocytes Primary Antibody Concentration: 1:100 Secondary Antibody: Donkey anti-Rabbit-Cy3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec

Western Blot: Alanyl tRNA synthetase Antibody [NBP1-57136] - Reccomended Titration: 0.2 - 1 ug/ml Positive Control: Jurkat cell lysate AARS is supported by BioGPS gene expression data to be expressed in Jurkat

Immunohistochemistry: Alanyl tRNA synthetase Antibody [NBP1-57136] - Paraffin Embedded Tissue: Human Heart cell Cellular Data: cardiac cell of renal tubule Antibody Concentration: 4.0 - 8.0 ug/ml Magnification: 400X

Immunohistochemistry: Alanyl tRNA synthetase Antibody [NBP1-57136] - Formalin Fixed Paraffin Embedded Tissue: Human Adult heart Observed Staining: Cytoplasmic Primary Antibody Concentration: 1:600 Secondary Antibody: Donkey anti-Rabbit-Cy2/3 Secondary Antibody Concentration: 1:200 Magnification: 20X Exposure Time: 0.5 - 2.0 sec Protocol located in Reviews and Data.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Alanyl tRNA synthetase Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to AARS(alanyl-tRNA synthetase) The peptide sequence was selected from the C terminal of AARS. Peptide sequence VTGAEAQKALRKAESLKKCLSVMEAKVKAQTAPNKDVQREIADLGEALAT. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AARS1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Alanyl tRNA synthetase Antibody - BSA Free

• alanine tRNA ligase 1, cytoplasmic
• Alanine--tRNA ligase
• alanyl-tRNA synthetase
• alanyl-tRNA synthetase, cytoplasmic
• alaRS
• CMT2N
• EC 6.1.1
• EC 6.1.1.7
• Renal carcinoma antigen NY-REN-42

Background

The human alanyl-tRNA synthetase (AARS) belongs to a family of tRNA synthases, of the class II enzymes. Class II tRNA synthases evolved early in evolution and are highly conserved. This is reflected by the fact that 498 of the 968-residue polypeptide human AARS shares 41% identity witht the E.coli protein. tRNA synthases are the enzymes that interpret the RNA code and attach specific aminoacids to the tRNAs that contain the cognate trinucleotide anticodons. They consist of a catalytic domain which interacts with the amino acid acceptor-T psi C helix of the tRNA, and a second domain which interacts with the rest of the tRNA structure. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AARS1
• Entrez:
  • 16(Human)
• Uniprot:
  • P49588(Human)