Recombinant Human AKR1CL2 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human AKR1CL2 Protein Summary

Description
A recombinant protein with GST tag at N-terminal corresponding to the amino acids 1-307 of Human AKR1CL2 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MGDIPAVGLSSWKASPGKVTEAVKEAIDAGYRHFDCAYFYHNEREVGAGIRCKIKEGAVRREDLFIATKLWCTCHKKSLVETACRKSLKALKLNYLDLYLIHWPMGFKPPHPEWIMSCSELSFCLSHPRVQDLPLDESNMVIPSDTDFLDTWEAMEDLVITGLVKNIGVSNFNHEQLERLLNKPGLRFKPLTNQIECHPYLTQKNLISFCQSRDVSVTAYRPLGGSCEGVDLIDNPVIKRIAKEHGKSPAQILIRFQIQRNVIVIPGSITPSHIKENIQVFDFELTQHDMDNILSLNRNLRLAMFPM

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Recombinant Protein
Gene
AKR1E2
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human AKR1CL2 Protein

  • AF reductase
  • AKR1CL2
  • AKRDC1
  • Aldo-keto reductase family 1 member C-like protein 21,5-anhydro-D-fructose reductase
  • Aldo-keto reductase family 1 member E2
  • aldo-keto reductase family 1, member C-like 2
  • aldo-keto reductase family 1, member E2
  • aldo-keto reductase loopADR
  • aldo-keto reductase related protein
  • EC 1.1.1
  • EC 1.1.1.263
  • hTSP
  • LoopADR
  • MGC10612
  • Testis-specific protein

Background

AKR1CL2( AAH02862, 1 a.a. - 308 a.a.) recombinant protein with GST.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-41198
Species: Hu, Mu
Applications: WB, ELISA
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
NBP2-37463
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready
AF1356
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00007016-R03
Species: Hu
NBP1-91787
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-31452
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-81760
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-80933
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56603
Species: Hu, Pm
Applications: WB, IHC, IHC-P
MAB6000
Species: Hu
Applications: ICC/IF (-), WB, Flow, IHC, CyTOF-ready
NBP2-47266
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-30943
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-85409
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB110-3638
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, RI

Publications for AKR1CL2 Recombinant Protein (H00083592-P01) (0)

There are no publications for AKR1CL2 Recombinant Protein (H00083592-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKR1CL2 Recombinant Protein (H00083592-P01) (0)

There are no reviews for AKR1CL2 Recombinant Protein (H00083592-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AKR1CL2 Recombinant Protein (H00083592-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AKR1CL2 Products

Bioinformatics Tool for AKR1CL2 Recombinant Protein (H00083592-P01)

Discover related pathways, diseases and genes to AKR1CL2 Recombinant Protein (H00083592-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKR1CL2 Recombinant Protein (H00083592-P01)

Discover more about diseases related to AKR1CL2 Recombinant Protein (H00083592-P01).

Blogs on AKR1CL2

There are no specific blogs for AKR1CL2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

AKR1CL2 Antibody
NBP1-90195
p19ARF Antibody
NB200-106

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human AKR1CL2 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AKR1E2