AKAP11 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: AKAP11 Antibody [NBP1-89169] - Staining of human cell line U-2 OS shows positivity in nucleoli, plasma membrane and cytoplasm.
Immunohistochemistry-Paraffin: AKAP11 Antibody [NBP1-89169] - Staining of human kidney shows strong cytoplasmic positivity in cells in tubules.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AKAP11 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:EHSGKKVQFAEALATHILSLATEMAASHLDNKIIQEPKVKNPCLNVQSQRSVSPTFLNPSDENLKTLCNFAGDLAAEVITEAEKIAKVRNCM
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AKAP11
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
AKAP11 Protein (NBP1-89169PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AKAP11 Antibody

  • A kinase (PRKA) anchor protein 11
  • AKAP 220
  • AKAP-11
  • AKAP220hAKAP220
  • A-kinase anchor protein 220 kDa
  • A-kinase anchoring protein, 220kDa
  • DKFZp781I12161
  • FLJ11304
  • KIAA0629a kinase anchor protein 220 kDa
  • PRKA11A-kinase anchor protein 11
  • protein kinase A anchoring protein 11
  • Protein kinase A-anchoring protein 11

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89172
Species: Hu
Applications: WB, IHC, IHC-P
H00011214-M10
Species: Hu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP1-31348
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NLS1071
Species: Hu
Applications: IHC-P
NBP2-38713
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-06529
Species: Hu
Applications: WB, IHC-P, IP, PLA
NBP1-47470
Species: Hu, Mu, Rt, Pm
Applications: WB, Simple Western, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-82778
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-38049
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-21395
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IP

Publications for AKAP11 Antibody (NBP1-89169) (0)

There are no publications for AKAP11 Antibody (NBP1-89169).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AKAP11 Antibody (NBP1-89169) (0)

There are no reviews for AKAP11 Antibody (NBP1-89169). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for AKAP11 Antibody (NBP1-89169) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AKAP11 Products

Bioinformatics Tool for AKAP11 Antibody (NBP1-89169)

Discover related pathways, diseases and genes to AKAP11 Antibody (NBP1-89169). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AKAP11 Antibody (NBP1-89169)

Discover more about diseases related to AKAP11 Antibody (NBP1-89169).
 

Pathways for AKAP11 Antibody (NBP1-89169)

View related products by pathway.

PTMs for AKAP11 Antibody (NBP1-89169)

Learn more about PTMs related to AKAP11 Antibody (NBP1-89169).

Blogs on AKAP11

There are no specific blogs for AKAP11, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AKAP11 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AKAP11
Entrez
Uniprot