AKAP11 Antibody - BSA Free

Immunohistochemistry-Paraffin: AKAP11 Antibody [NBP1-89169] - Staining in human kidney and skeletal muscle tissues using anti-AKAP11 antibody. Corresponding AKAP11 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: AKAP11 Antibody [NBP1-89169] - Staining of human kidney shows high expression.

Immunohistochemistry-Paraffin: AKAP11 Antibody [NBP1-89169] - Staining of human skeletal muscle shows low expression as expected.

• Reactivity: Hu
• Applications: IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

AKAP11 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit AKAP11 Antibody - BSA Free (NBP1-89169) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: EHSGKKVQFAEALATHILSLATEMAASHLDNKIIQEPKVKNPCLNVQSQRSVSPTFLNPSDENLKTLCNFAGDLAAEVITEAEKIAKVRNCM
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AKAP11
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  AKAP11 Protein (NBP1-89169PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for AKAP11 Antibody - BSA Free

• A kinase (PRKA) anchor protein 11
• AKAP 220
• AKAP-11
• AKAP220hAKAP220
• A-kinase anchor protein 220 kDa
• A-kinase anchoring protein, 220kDa
• DKFZp781I12161
• FLJ11304
• KIAA0629a kinase anchor protein 220 kDa
• PRKA11A-kinase anchor protein 11
• protein kinase A anchoring protein 11
• Protein kinase A-anchoring protein 11

Background

AKAP11, also known as A-kinase anchor protein 11, consists of a 1,901 amino acid isoform that is 211 kDa, and is involved in the control of somatic and germ cell cycles by targeting and binding to protein kinase A. Research is not currently being conducted on AKAP11's relation to any diseases or disorders. This protein interacts with GSK3B, PRKAR1A, PRKAR2A, PRKAR2B, and PPP1CA during the cAMP Pathway and the G Protein Signaling Pathway.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AKAP11
• Entrez:
  • 11215(Human)
• Uniprot:
  • Q9UKA4(Human)