Recombinant Human Ajuba Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human Ajuba Protein Summary

Description
Ajuba (Human) GST-Tagged Recombinant Protein

Source: Wheat Germ (in vitro)

Amino Acid Sequence: IPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGCEDIVRVISMDRDYHFECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLNARQPPANYI
Preparation
Method
in vitro wheat germ expression system
Protein/Peptide Type
Partial Recombinant Protein
Gene
AJUBA

Applications/Dilutions

Application Notes
Useful in Western Blot and ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ajuba Protein

  • Ajuba
  • JUB
  • jub, ajuba homolog (Xenopus laevis)
  • MGC15563
  • protein ajuba

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-47516
Species: Hu, Mu, Ha, Mk, Pm
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-36768
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00009260-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IP
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB8494
Species: Hu
Applications: WB, IHC, ICC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56641
Species: Hu, Mu
Applications: WB
H00126374-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-26506
Species: Hu, Mu, Rt
NBP2-37576
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
NB100-56749
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-79791
Species: Hu
Applications: WB
AF4937
Species: Hu
Applications: WB, IHC
NBP1-83976
Species: Hu
Applications: ICC/IF, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
H00084962-Q01
Species: Hu
Applications: WB, ELISA, PA

Publications for Ajuba Partial Recombinant Protein (H00084962-Q01) (0)

There are no publications for Ajuba Partial Recombinant Protein (H00084962-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ajuba Partial Recombinant Protein (H00084962-Q01) (0)

There are no reviews for Ajuba Partial Recombinant Protein (H00084962-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ajuba Partial Recombinant Protein (H00084962-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Ajuba Products

Bioinformatics Tool for Ajuba Partial Recombinant Protein (H00084962-Q01)

Discover related pathways, diseases and genes to Ajuba Partial Recombinant Protein (H00084962-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ajuba Partial Recombinant Protein (H00084962-Q01)

Discover more about diseases related to Ajuba Partial Recombinant Protein (H00084962-Q01).
 

Pathways for Ajuba Partial Recombinant Protein (H00084962-Q01)

View related products by pathway.

PTMs for Ajuba Partial Recombinant Protein (H00084962-Q01)

Learn more about PTMs related to Ajuba Partial Recombinant Protein (H00084962-Q01).
 

Research Areas for Ajuba Partial Recombinant Protein (H00084962-Q01)

Find related products by research area.

Blogs on Ajuba

There are no specific blogs for Ajuba, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Ajuba Antibody
NBP1-89570
Ajuba Antibody
NBP1-89570
Ajuba Antibody
NBP1-89570

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ajuba Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AJUBA
Entrez