Recombinant Human Ajuba Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human Ajuba Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 439-538 of Human Ajuba

Source: Wheat Germ

Amino Acid Sequence: IPFTVDFSNQVYCVTDYHKNYAPKCAACGQPILPSEGCEDIVRVISMDRDYHFECYHCEDCRMQLSDEEGCCCFPLDGHLLCHGCHMQRLNARQPPANYI

Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
AJUBA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
36.74 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human Ajuba Protein

  • Ajuba
  • JUB
  • jub, ajuba homolog (Xenopus laevis)
  • MGC15563
  • protein ajuba

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89549
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84843
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB6977
Species: Hu, Mu, Rt
Applications: WB, IHC, ICC
NBP1-84841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87789
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-80833
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB8494
Species: Hu
Applications: WB, IHC, ICC
AF748
Species: Hu, Mu
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NB100-56641
Species: Hu, Mu
Applications: WB
H00126374-B01P
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-67327
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
NBP2-26506
Species: Hu, Mu, Rt
NBP2-67471
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
NBP1-51843
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
NB100-79791
Species: Hu
Applications: WB
AF4937
Species: Hu
Applications: WB, IHC
NBP1-69368
Species: Hu
Applications: WB, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
H00084962-Q01
Species: Hu
Applications: WB, ELISA, PA, AP

Publications for Ajuba Partial Recombinant Protein (H00084962-Q01) (0)

There are no publications for Ajuba Partial Recombinant Protein (H00084962-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Ajuba Partial Recombinant Protein (H00084962-Q01) (0)

There are no reviews for Ajuba Partial Recombinant Protein (H00084962-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Ajuba Partial Recombinant Protein (H00084962-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for Ajuba Partial Recombinant Protein (H00084962-Q01)

Discover related pathways, diseases and genes to Ajuba Partial Recombinant Protein (H00084962-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Ajuba Partial Recombinant Protein (H00084962-Q01)

Discover more about diseases related to Ajuba Partial Recombinant Protein (H00084962-Q01).
 

Pathways for Ajuba Partial Recombinant Protein (H00084962-Q01)

View related products by pathway.

PTMs for Ajuba Partial Recombinant Protein (H00084962-Q01)

Learn more about PTMs related to Ajuba Partial Recombinant Protein (H00084962-Q01).
 

Research Areas for Ajuba Partial Recombinant Protein (H00084962-Q01)

Find related products by research area.

Blogs on Ajuba

There are no specific blogs for Ajuba, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Ajuba Antibody
NBP1-89570

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human Ajuba Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol AJUBA
Entrez