AGPAT5 Antibody

Images

 
Western Blot: AGPAT5 Antibody [NBP1-83768] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: AGPAT5 Antibody [NBP1-83768] - Staining of human corpus, uterine shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

AGPAT5 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:VAFDCMKNYLDAIYDVTVVYEGKDDGGQRRESPTMTEFLCKECPKIHIHIDRIDKKDVPEEQEHMRRWLHERFEIKDKMLIEFYESPDPERRKRFPGKSVNSKLSIKKTLPSMLILSGLTAGMLMTDAGRKLY
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
AGPAT5
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
AGPAT5 Protein (NBP1-83768PEP)
Publications
Read Publication using NBP1-83768.

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23435261)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for AGPAT5 Antibody

  • 1-acylglycerol-3-phosphate O-acyltransferase 5 (lysophosphatidic acidacyltransferase, epsilon)
  • 1-acyl-sn-glycerol-3-phosphate acyltransferase epsilon
  • 1-AGPAT 5,1-acylglycerol-3-phosphate O-acyltransferase 5
  • 1AGPAT5,1-AGP acyltransferase 5
  • EC 2.3.1.51
  • FLJ11210
  • LPAATE
  • LPAAT-e
  • LPAAT-epsilon
  • Lysophosphatidic acid acyltransferase epsilon

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-74276
Species: Hu
Applications: WB
NBP2-30948
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-07799
Species: Hu
H00005554-R02
Species: Hu
NBP1-47659
Species: Hu
Applications: WB, IHC, IHC-P
H00002038-M01
Species: Hu
Applications: WB, ELISA, ICC/IF
AF2605
Species: Hu
Applications: WB, Simple Western, IHC, ICC
NBP2-32664
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-98414
Species: Hu, Mu
Applications: WB
H00009056-B01P
Species: Hu, Rt
Applications: WB
NB100-61628
Species: Hu, Mu
Applications: IP (-), WB, Simple Western, ICC/IF, IHC, IHC-P, PLA
NBP1-76907
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37477
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC
NBP1-88927
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-94157
Species: Hu
Applications: IHC, IHC-P
NBP2-58953
Species: Hu
Applications: ICC/IF
NB300-537
Species: Hu, Mu, Rt, Bv, Rb
Applications: WB, ChIP, Flow, GS, ICC/IF, IHC, IHC-P, IP
NBP1-83768
Species: Hu
Applications: WB, IHC, IHC-P

Publications for AGPAT5 Antibody (NBP1-83768)(1)

Reviews for AGPAT5 Antibody (NBP1-83768) (0)

There are no reviews for AGPAT5 Antibody (NBP1-83768). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for AGPAT5 Antibody (NBP1-83768) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional AGPAT5 Products

Bioinformatics Tool for AGPAT5 Antibody (NBP1-83768)

Discover related pathways, diseases and genes to AGPAT5 Antibody (NBP1-83768). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for AGPAT5 Antibody (NBP1-83768)

Discover more about diseases related to AGPAT5 Antibody (NBP1-83768).
 

Pathways for AGPAT5 Antibody (NBP1-83768)

View related products by pathway.

Research Areas for AGPAT5 Antibody (NBP1-83768)

Find related products by research area.

Blogs on AGPAT5

There are no specific blogs for AGPAT5, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our AGPAT5 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol AGPAT5