AGO1/EIF2C1 Antibody - BSA Free

Western Blot: AGO1/EIF2C1 Antibody [NBP2-86572] - Host: Rabbit. Target Name: EIF2C1. Sample Tissue: Human K562 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Discontinued

AGO1/EIF2C1 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of human AGO1/EIF2C1. Peptide sequence: RSVSIPAPAYYARLVAFRARYHLVDKEHDSGEGSHISGQSNGRDPQALAK The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AGO1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for AGO1/EIF2C1 Antibody - BSA Free

• AGO1Q99
• argonaute 1
• argonaute1
• DKFZp686M13167
• eIF2C 1
• eIF-2C 1
• EIF2C
• Eukaryotic translation initiation factor 2C 1
• eukaryotic translation initiation factor 2C, 1
• GERP95
• Golgi Endoplasmic Reticulum protein 95 kDa
• hAgo1
• protein argonaute-1
• Putative RNA-binding protein Q99

Background

The AGO1/EIF2C1 gene encodes a member of the Argonaute family of proteins which play a role in RNA interference. The encoded protein is highly basic, and contains a PAZ domain and a PIWI domain. It may interact with dicer1 and play a role in short-interfering-RNA-me

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AGO1