AGFG2 Recombinant Protein Antigen

• Reactivity: Hu
• Applications: AC

AGFG2 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AGFG2
  
  

  Source: E.coli

  Amino Acid Sequence: MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDITVGSFVCTTCSGLLRGLN

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: AGFG2
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10-100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-25269It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AGFG2 Recombinant Protein Antigen

• ArfGAP with FG repeats 2
• HIV-1 Rev binding protein-like
• HIV-1 Rev-binding protein-like protein
• HRBLnucleoporin
• RAB-R
• RABRarf-GAP domain and FG repeats-containing protein 2
• Rev/Rex activation domain binding protein-related
• Rev/Rex activation domain-binding protein related

Background

AGFG2 codes for a protein is 481 amino acids long and weighs approximately 49 kDa, with a short isoform with a length of 156 amino acids and a weight of approximately 17 kDa. AGFG2 codes for a protein that helps control the necleocytoplasmic transfer of proteins and RNAs, which is a process known as the Rev export pathway. Current studies are being done on several diseases and disorders relating to this gene, including xerophthalmia and bronchiectasis. AGFG2 has also been shown to have interactions with EPS15L1, EPS15, and ITSN1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AGFG2