AGFG2 Recombinant Protein Antigen

Images

 
There are currently no images for AGFG2 Recombinant Protein Antigen (NBP3-17465PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

AGFG2 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human AGFG2

Source: E. coli

Amino Acid Sequence: KPLRTLLGDPAPSLSVAASTSSQPVSQSHARTSQARSTQPPPHSSVKKASTDLLADIGGDPFAAPQMAPAF

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
AGFG2
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17465.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for AGFG2 Recombinant Protein Antigen

  • ArfGAP with FG repeats 2
  • HIV-1 Rev binding protein-like
  • HIV-1 Rev-binding protein-like protein
  • HRBLnucleoporin
  • RAB-R
  • RABRarf-GAP domain and FG repeats-containing protein 2
  • Rev/Rex activation domain binding protein-related
  • Rev/Rex activation domain-binding protein related

Background

AGFG2 codes for a protein is 481 amino acids long and weighs approximately 49 kDa, with a short isoform with a length of 156 amino acids and a weight of approximately 17 kDa. AGFG2 codes for a protein that helps control the necleocytoplasmic transfer of proteins and RNAs, which is a process known as the Rev export pathway. Current studies are being done on several diseases and disorders relating to this gene, including xerophthalmia and bronchiectasis. AGFG2 has also been shown to have interactions with EPS15L1, EPS15, and ITSN1.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB400-148
Species: ChHa, Ha, Hu, Mu, Po, Pm, Rt
Applications: EM, ICC/IF, IHC,  IHC-P, IP, KD, KO, WB
NB120-2938
Species: Bv, Hu, Mu
Applications: IHC,  IHC-P, WB
NBP1-31381
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, IP, WB
NBP2-61832
Species: Hu, Pm, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
NB100-93325
Species: Hu
Applications: ICC/IF, IP, WB
NBP1-19151
Species: Bv, Hu, Ma
Applications: ICC/IF, IHC,  IHC-P, IP, WB
H00008878-M01
Species: Bv, Ha, Hu, Mu, Rb, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-37399
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, ICC/IF, IHC,  IHC-P, WB
H00002965-M01
Species: Hu
Applications: ELISA, ICC/IF, IHC,  IHC-P, KD, S-ELISA, WB
NBP2-02627
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NB100-2244
Species: Hu
Applications: IHC,  IHC-P, IP, WB
H00029107-M08
Species: Hu
Applications: ELISA, ICC/IF, KD, S-ELISA, WB
NB100-93329
Species: Hu
Applications: ICC/IF, IP, KO, WB
NBP1-31649
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81546
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-76926
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
NBP1-82520
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
NBP1-82525
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-93336
Species: Hu
Applications: IP, WB
NBP3-17465PEP
Species: Hu
Applications: AC

Publications for AGFG2 Recombinant Protein Antigen (NBP3-17465PEP) (0)

There are no publications for AGFG2 Recombinant Protein Antigen (NBP3-17465PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for AGFG2 Recombinant Protein Antigen (NBP3-17465PEP) (0)

There are no reviews for AGFG2 Recombinant Protein Antigen (NBP3-17465PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for AGFG2 Recombinant Protein Antigen (NBP3-17465PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional AGFG2 Products

Blogs on AGFG2.

Niemann Pick-C1 and cholesterol dynamics
Niemann-Pick type C1 (NPC1) mediates low-density cholesterol transport from late endosomes and lysosomes to other areas of the cell via receptor mediation endocytosis.  Although cholesterol moves freely inside the cell, it cannot independently expo...  Read full blog post.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our AGFG2 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol AGFG2