ADTB1 Antibody - BSA Free

Western Blot: ADTB1 Antibody [NBP1-68947] - ADTB1 Antibody Mouse WT brain and Rat brain, concentration 2ug/ml.

Western Blot: ADTB1 Antibody [NBP1-68947] - ADTB1 Antibody Human Muscle lysate, concentration 0.2-1 ug/ml.

• Reactivity: Hu
• Applications: WB, IP
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ADTB1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to AP1B1 (adaptor-related protein complex 1, beta 1 subunit) The peptide sequence was selected from the C terminal of AP1B1. Peptide sequence KLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKE. The peptide sequence for this immunogen was taken from within the described region.
• Specificity: This product is specific to Subunit or Isoform: beta-1.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AP1B1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunoprecipitation
  • Western Blot 1.0 ug/ml
• Theoretical MW: 104 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ADTB1 Antibody - BSA Free

• Adapter-Related Protein Complex 1 Subunit Beta-1
• Adaptor Protein Complex AP-1 Subunit Beta-1
• Adaptor-Related Protein Complex 1, Beta 1 Subunit
• AP-1 Complex Subunit Beta-1
• AP105A
• AP1B1
• BAM22
• beta-1-adaptin
• beta1-adaptin
• Beta-Adaptin 1
• beta-prime-adaptin
• CLAPB2
• Clathrin Assembly Protein Complex 1 Beta Large Chain
• Golgi Adaptor HA1/AP1 Adaptin Beta Subunit
• Plasma Membrane Adaptor HA2/AP2 Adaptor Beta Subunit

Background

ADTB1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. This complex is a heterotetramer composed of two large, one medium, and one small adaptin subunit. The protein encoded by this gene serves as one of the large subunits of this complex and is a member of the adaptin protein family. This gene is a candidate meningioma gene. Alternative splicing results in multiple transcript variants.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AP1B1
• Uniprot:
  • Q10567(Human)