ADTB1 Antibody


Western Blot: ADTB1 Antibody [NBP1-68947] - ADTB1 Antibody Mouse WT brain and Rat brain, concentration 2ug/ml.
Western Blot: ADTB1 Antibody [NBP1-68947] - ADTB1 Antibody Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB

Order Details

ADTB1 Antibody Summary

Synthetic peptides corresponding to AP1B1 (adaptor-related protein complex 1, beta 1 subunit) The peptide sequence was selected from the C terminal of AP1B1. Peptide sequence KLFLKKPTETQELVQQVLSLATQDSDNPDLRDRGYIYWRLLSTDPVAAKE.
This product is specific to Subunit or Isoform: beta-1.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against AP1B1 and was validated on Western blot.
Theoretical MW
104 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Store at -20C. Avoid freeze-thaw cycles.
PBS and 2% Sucrose
0.09% Sodium Azide
Immunogen affinity purified


The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ADTB1 Antibody

  • Adapter-Related Protein Complex 1 Subunit Beta-1
  • Adaptor Protein Complex AP-1 Subunit Beta-1
  • Adaptor-Related Protein Complex 1, Beta 1 Subunit
  • AP-1 Complex Subunit Beta-1
  • AP105A
  • AP1B1
  • BAM22
  • beta-1-adaptin
  • beta1-adaptin
  • Beta-Adaptin 1
  • beta-prime-adaptin
  • CLAPB2
  • Clathrin Assembly Protein Complex 1 Beta Large Chain
  • Golgi Adaptor HA1/AP1 Adaptin Beta Subunit
  • Plasma Membrane Adaptor HA2/AP2 Adaptor Beta Subunit


ADTB1 is found at the cytoplasmic face of coated vesicles located at the Golgi complex, where it mediates both the recruitment of clathrin to the membrane and the recognition of sorting signals within the cytosolic tails of transmembrane receptors. This complex is a heterotetramer composed of two large, one medium, and one small adaptin subunit. The protein encoded by this gene serves as one of the large subunits of this complex and is a member of the adaptin protein family. This gene is a candidate meningioma gene. Alternative splicing results in multiple transcript variants.


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IP (-), WB
Species: Hu
Applications: WB
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
Species: Hu, Mu, Rt, Ca
Applications: WB, ICC/IF
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: Flow, CyTOF-ready, ICFlow
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, S-ELISA
Species: Hu
Applications: WB, Flow, IHC, CyTOF-ready
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ADTB1 Antibody (NBP1-68947) (0)

There are no publications for ADTB1 Antibody (NBP1-68947).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADTB1 Antibody (NBP1-68947) (0)

There are no reviews for ADTB1 Antibody (NBP1-68947). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADTB1 Antibody (NBP1-68947) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional ADTB1 Products

Bioinformatics Tool for ADTB1 Antibody (NBP1-68947)

Discover related pathways, diseases and genes to ADTB1 Antibody (NBP1-68947). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADTB1 Antibody (NBP1-68947)

Discover more about diseases related to ADTB1 Antibody (NBP1-68947).

Pathways for ADTB1 Antibody (NBP1-68947)

View related products by pathway.

PTMs for ADTB1 Antibody (NBP1-68947)

Learn more about PTMs related to ADTB1 Antibody (NBP1-68947).

Research Areas for ADTB1 Antibody (NBP1-68947)

Find related products by research area.

Blogs on ADTB1

There are no specific blogs for ADTB1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our ADTB1 Antibody and receive a gift card or discount.


Gene Symbol AP1B1