ADPRM Antibody

Images

 
Western Blot: ADPRM Antibody [NBP1-70766] - NCI-H226 cell lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADPRM Antibody Summary

Immunogen
Synthetic peptides corresponding to C17ORF48 The peptide sequence was selected from the middle region of C17orf48. Peptide sequence KYEQCMKILREHNPNTELNSPQGLSEPQFVQFNGGFSQEQLNWLNEVLTF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADPRM
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against C17orf48 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ADPRM Antibody

  • ADPRibase-Mn
  • ADP-ribose/CDP-alcohol diphosphatase, manganese-dependent
  • ADPRM
  • C17orf48
  • chromosome 17 open reading frame 48
  • manganese-dependent ADP-ribose/CDP-alcohol diphosphatase
  • MDS006
  • NBLA03831

Background

The function of this protein remains unknown.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB110-81601
Species: Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr
AF2747
Species: Mu
Applications: WB, IHC, IP, ELISA(Cap), ELISA(Det), ELISA(Sta)
UL-950
Species: Hu
NB100-553
Species: Hu, Mu
Applications: WB, IHC-P
NBP2-24571
Species: Hu, Mu
Applications: WB, Simple Western, IHC-P
NBP1-80609
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16396
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-30881
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-20065
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-15141
Species: Hu
Applications: WB
NBP2-13252
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-84973
Species: Hu
Applications: IHC, IHC-P
NBP1-89009
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-50553
Species: Hu, Mu
Applications: WB, IHC-P
NBP1-06986
Species: Hu, Mu, Rt
Applications: WB, ELISA, EIA, IHC, IHC-P, PEP-ELISA
NBP1-70766
Species: Hu
Applications: WB

Publications for ADPRM Antibody (NBP1-70766) (0)

There are no publications for ADPRM Antibody (NBP1-70766).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADPRM Antibody (NBP1-70766) (0)

There are no reviews for ADPRM Antibody (NBP1-70766). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADPRM Antibody (NBP1-70766) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ADPRM Products

Bioinformatics Tool for ADPRM Antibody (NBP1-70766)

Discover related pathways, diseases and genes to ADPRM Antibody (NBP1-70766). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ADPRM

There are no specific blogs for ADPRM, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADPRM Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ADPRM