Recombinant Human ADNP GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human ADNP GST (N-Term) Protein Summary

Description
A recombinant protein with a N-terminal GST tag corresponding to the amino acid sequence 1018-1102 of Human ADNP

Source: Wheat Germ (in vitro)

Amino Acid Sequence: TMQGDREQLKWKNSSYGKVEGFWSKDQSQWKNASENDERLSNPQIEWQNSTIDSEDGEQFDNMTDGVAEPMHGSLAGVKLSSQQA

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Partial Recombinant Protein
Gene
ADNP
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Theoretical MW
35.09 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ADNP GST (N-Term) Protein

  • Activity-dependent neuroprotective protein
  • activity-dependent neuroprotector homeobox
  • activity-dependent neuroprotector
  • ADNP homeobox 1
  • ADNP
  • ADNP1
  • ADNP1KIAA0784activity-dependent neuroprotector homeobox protein

Background

ADNP - activity-dependent neuroprotector

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37252
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
NBP1-05163
Species: Hu, Rt, Po, Bv
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
AF6380
Species: Mu
Applications: WB
AF1085
Species: Mu
Applications: WB, IHC, Neut
NB100-82245
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P, KD
NBP1-81468
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-92287
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-13075
Species: Hu, Mu, Rt, Pm
Applications: WB, DB, ELISA, IB, ICC/IF, IHC, IHC-Fr, IHC-P, IP, IHC-FrFl
NB110-89474
Species: Hu, Mu, Rt, Bv, Ce, ChHa, Pm, RM
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, ISH, Dual ISH-IHC, Single-Cell Western
NB300-141
Species: Hu, Mu, Rt, Po, Bv, Ch, Eq, Gp, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-Fr, IHC-P
NB100-858
Species: Hu, Mu, Rt, Gp
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, PEP-ELISA, IHC-WhMt
NB300-605
Species: Hu, Mu, Rt, Po
Applications: WB, Flow, IB, ICC/IF, IHC, IHC-P, In vitro
NBP2-13215
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56708
Species: Hu, Mu, Rt, Po, Ch, ChHa, Ma
Applications: WB, Simple Western, EM, Flow, HEStain, IB, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, IHC-FrFl, KD, KO
NBP2-24915
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for ADNP Partial Recombinant Protein (H00023394-Q01) (0)

There are no publications for ADNP Partial Recombinant Protein (H00023394-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADNP Partial Recombinant Protein (H00023394-Q01) (0)

There are no reviews for ADNP Partial Recombinant Protein (H00023394-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADNP Partial Recombinant Protein (H00023394-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Other Available Formats

Additional ADNP Products

Bioinformatics Tool for ADNP Partial Recombinant Protein (H00023394-Q01)

Discover related pathways, diseases and genes to ADNP Partial Recombinant Protein (H00023394-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADNP Partial Recombinant Protein (H00023394-Q01)

Discover more about diseases related to ADNP Partial Recombinant Protein (H00023394-Q01).
 

Pathways for ADNP Partial Recombinant Protein (H00023394-Q01)

View related products by pathway.

PTMs for ADNP Partial Recombinant Protein (H00023394-Q01)

Learn more about PTMs related to ADNP Partial Recombinant Protein (H00023394-Q01).
 

Research Areas for ADNP Partial Recombinant Protein (H00023394-Q01)

Find related products by research area.

Blogs on ADNP

There are no specific blogs for ADNP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ADNP GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol ADNP