ADAMTS17 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: ADAMTS17 Antibody [NBP2-56304] - Staining of human cell line HEK 293 shows localization to nucleus.

• Reactivity: Hu
• Applications: ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ADAMTS17 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QVRRCNLHPCQSRWVAGPWSPCSATCEKGFQHREVTCVYQLQNGTHVATRPLYCPGPRPAAVQSCEGQDCLSIWEASEWS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAMTS17
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  ADAMTS17 Recombinant Protein Antigen (NBP2-56304PEP)

Reactivity Notes

Mouse 88%, Rat 89%

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ADAMTS17 Antibody - BSA Free

• A disintegrin and metalloproteinase with thrombospondin motifs 17
• a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 17
• ADAM metallopeptidase with thrombospondin type 1 motif, 17
• ADAM-TS 17
• ADAM-TS17
• ADAMTS-17
• EC 3.4.24
• EC 3.4.24.-
• EC 3.4.24.80
• EC 3.4.24.82
• FLJ16363
• FLJ32769

Background

ADAMTS17 encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has a high sequence similarity to the protein encoded by ADAMTS19, another family member. The function of this protein has not been determined.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAMTS17