ADAM8 Antibody - BSA Free

Western Blot: ADAM8 Antibody [NBP3-10837] - Western blot analysis of ADAM8 in Mouse Testis lysates. Antibody dilution at 1ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ADAM8 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of mouse ADAM8 (NP_031429.1). Peptide sequence GQYPESLSYALGTSGHVFTLHLRKNRDLLGSSYTETYSAANGSEVTEQLQ
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ADAM8
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 90 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ADAM8 Antibody - BSA Free

• a disintegrin and metalloproteinase domain 8
• ADAM 8
• ADAM metallopeptidase domain 8
• ADAM8
• CD156a antigen
• CD156a
• CD156human leukocyte differentiation antigen
• Cell surface antigen MS2
• EC 3.4.24
• EC 3.4.24.-
• MGC134985
• MS2
• MS2disintegrin and metalloproteinase domain-containing protein 8

Background

Members of ADAM family are cell surface proteins with a unique structure possessing both potential adhesion and protease domains. The extracellular region of ADAM8 shows significant amino acid sequence homology to hemorrhagic snake venom proteins, including the metalloprotease and disintegrin domains. The expression of ADAM8 is upregulated by retinoic acid and vitamin D3. ADAM8 is involved in protein processing at the cell surface and is also thought to act as a leukocyte differentiation marker.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ADAM8