We're moving to rndsystems.com. Come with us!

After August 17, 2026, Novus Biologicals products and services will no longer be available on this website; you will access all products and services on rndsystems.com. Create your R&D Systems online account today.

ADAM23 Recombinant Protein Antigen

Images

 

Product Details

Summary
Product Discontinued
View other related ADAM23 Peptides and Proteins

Order Details


    • Catalog Number
      NBP1-81250PEP
    • Availability
      Product Discontinued

    Can't find what you are looking for? Use our Antibody Concierge Service & we will help you locate your antibody!

    Or feel free to contact us for alternative products.

ADAM23 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ADAM23.

Source: E. coli

Amino Acid Sequence: LLVLLLLPPLAASSRPRAWGAAAPSAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ADAM23
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-81250.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
31 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ADAM23 Recombinant Protein Antigen

  • a disintegrin and metalloproteinase domain 23
  • ADAM metallopeptidase domain 23
  • ADAM23
  • disintegrin and metalloproteinase domain-containing protein 23
  • MDC3
  • MDC-3
  • MDC3ADAM 23
  • MDC-L
  • Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3

Background

ADAM23 is a non-catalytic metalloprotease-like protein. It is highly expressed in the brain, primarily in the amygdala, caudate nucleus, hypothalamus, thalamus, cerebral cortex and occipital pole, and weakly expressed in the heart. 3 isoforms are produced by alternative splicing, alpha, beta and gamma. ADAM23 may play a role in cell-cell and cell-matrix interactions. May play a role in cell-cell and cell-matrix interactions. This is a non-catalytic metalloprotease-like protein.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-15282
Species: Hu, Mu
Applications: IHC, IHC-Fr, WB
NBP2-92621
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, WB
AF949
Species: Hu, Mu
Applications: CyTOF-ready, Flow, IHC, IP, KO, WB
NBP2-42190
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
936-AD
Species: Hu
Applications: EnzAct
NB300-889
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA
NB200-106
Species: Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
DMD00
Species: Hu
Applications: ELISA
930-ADB
Species: Hu
Applications: EnzAct
H00084000-Q01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
NBP2-02450
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56326
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-67246
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
352-MS
Species: Hu
Applications: BA
NBP1-92025
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-56519
Species: Bv, Hu, Mu, Po, Rt, Sh
Applications: ChIP, CyTOF-ready, Flow-IC, Flow, ICC/IF, IHC-FrFl, IHC, IHC-Fr,  IHC-P, IP, KD, Simple Western, WB
H00008609-M01
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
NB300-213
Species: Fe, Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, KD, WB

Publications for ADAM23 Protein (NBP1-81250PEP) (0)

There are no publications for ADAM23 Protein (NBP1-81250PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADAM23 Protein (NBP1-81250PEP) (0)

There are no reviews for ADAM23 Protein (NBP1-81250PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ADAM23 Protein (NBP1-81250PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADAM23 Products

Blogs on ADAM23

There are no specific blogs for ADAM23, but you can read our latest blog posts.

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ADAM23 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ADAM23