Home » ADAM23 » ADAM23 Antibodies » ADAM23 Antibody

ADAM23 Antibody

 (1 Publication)
 See All Related
Submit a Review

Images

 
(
Enlarge)
Immunohistochemistry-Paraffin: ADAM23 Antibody [NBP1-81250] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells and in smooth muscle cells in the stroma.
Immunohistochemistry-Paraffin: ADAM23 Antibody [NBP1-81250] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells and in smooth muscle cells in the stroma.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

ADAM23 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: LLVLLLLPPLAASSRPRAWGAAAPSAPHWNETAEKNLGVLADEDNTLQQNSSSNISYSNAMQKEITLPSRLIYYINQDSESPYHVLDTKARHQQKHNKAVHLAQASFQIEAFGSKFILD
Specificity
Specificity of human ADAM23 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (93%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ADAM23
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot 0.04-0.4 ug/ml
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
IHC, WB reported in scientific literature (PMID: 24662834). For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ADAM23 Protein (NBP1-81250PEP)
Publications
Read Publication using
NBP1-81250 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Rat (87%). Human reactivity reported in scientific literature (PMID: 24662834).

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ADAM23 Antibody

  • a disintegrin and metalloproteinase domain 23
  • ADAM metallopeptidase domain 23
  • ADAM23
  • disintegrin and metalloproteinase domain-containing protein 23
  • MDC3
  • MDC-3
  • MDC3ADAM 23
  • MDC-L
  • Metalloproteinase-like, disintegrin-like, and cysteine-rich protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

ADAM22 Antibody
(498805) [Unconjugate
MAB49081
Western blot shows lysates of human brain (motor cortex) tissue, human brain (cerebellum) tissue, Jurkat human acute T cell leukemia cell line (negative control), and HepG2 human hepatocellular carcinoma cell line (negative control). PVDF membrane was probed with 2 µg/mL of Mouse Anti-Human ADAM22 Monoclonal Antibody (Catalog # MAB49081) followed by HRP-conjugated Anti-Mouse IgG Secondary Antibody (Catalog # HAF018). Specific bands were detected for ADAM22 at approximately 75 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Species: Hu
Applications: WB, IP
ADAM11 Antibody
NBP2-92621
Western Blot: ADAM11 Antibody [NBP2-92621] - Analysis of extracts of various cell lines, using ADAM11 at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 15s.
Immunocytochemistry/Immunofluorescence: ADAM11 Antibody [NBP2-92621] - Analysis of NIH/3T3 cells using ADAM11 at dilution of 1:100. Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: ADAM11 Antibody [NBP2-92621] - Analysis of C6 cells using ADAM11 at dilution of 1:100. Blue: DAPI for nuclear staining.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
ADAM9 Antibody
[Unconjugated]
AF949
Western blot shows lysates of HeLa human cervical epithelial carcinoma parental cell line and ADAM9 knockout HeLa cell line (KO). PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse ADAM9 Ectodomain Antigen Affinity-purified Polyclonal Antibody (Catalog # AF949) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). Specific bands were detected for ADAM9 at approximately 78 and 110 kDa (as indicated) in the parental HeLa cell line, but is not detectable in knockout HeLa cell line. GAPDH (Catalog # AF5718) is shown as a loading control. This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
Western blot shows lysates of C2C12 mouse myoblast cell line and WI‑38 human lung fibroblast cell line. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human/Mouse ADAM9 Ectodomain Antigen Affinity-purified Polyclonal Antibody (Catalog # AF949) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF017). Specific bands were detected for ADAM9 at approximately 110 and 80 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(8 Publications)
Species: Hu, Mu
Applications: WB, Flow, IHC, IP, CyTOF-ready, KO
Recombinant Human
Lgi1 GST (N-Term) Pro ...
H00009211-P01
Western Blot: Recombinant Human Lgi1 Protein [H00009211-P01] - The human recombinant LGI1 protein is recognized by a commercial antibody against LGI1. Lane 2: 0.4 ug; Lane 3: 0.2 ug). Lane 4: no protein. Image from verified customer review.
Recombinant Human Lgi1 Protein [H00009211-P01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
(1 Review)
(1 Publication)
Species: Hu
ADAM10
[Unconjugated]
936-AD
ADAM10 [Unconjugated]
(1 Review)
(18 Publications)
Species: Hu
ADAM12 Antibody
NB300-889
Immunocytochemistry/Immunofluorescence: ADAM12 Antibody [NB300-889] - Analysis of paraformaldehyde fixed A431 cells, permeabilized with 0.15% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (4ug/ml), showing cytoplasmic/plasma membrane staining. The nuclear stain is DAPI (blue). Negative control: Unimmunized goat IgG (10ug/ml) followed by Alexa Fluor 488 secondary antibody (4ug/ml).
Immunohistochemistry-Paraffin: ADAM12 Antibody [NB300-889] - Human Placenta. Steamed antigen retrieval with citrate buffer pH 6, AP-staining.
Flow Cytometry: ADAM12 Antibody [NB300-889] - Analysis of paraformaldehyde fixed HeLa cells (blue line), permeabilized with 0.5% Triton. Primary incubation 1hr (10ug/ml) followed by Alexa Fluor 488 secondary antibody (0.4ug/ml). IgG control: Unimmunized goat IgG (black line) followed by Alexa Fluor 488 secondary antibody.
(2 Publications)
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, PEP-ELISA
p19ARF/CDKN2A
Antibody
NB200-106
Western Blot: p19ARF/CDKN2A Antibody [NB200-106] - Analysis of p16INK4a/CDKN2A in (A) NIH/3T3 and (B) MEF cells.
Immunocytochemistry/Immunofluorescence: p19ARF/CDKN2A Antibody [NB200-106] - Antibody was tested in MEF cells with DyLight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red).
Immunohistochemistry: p19ARF/CDKN2A Antibody [NB200-106] - Adult mouse kidney (glomerulus). Image from verified customer review.
(1 Review)
(42 Publications)
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
CCL22/MDC [HRP]
DMD00
(1 Review)
(26 Publications)
Species: Hu
TACE/ADAM17
[Unconjugated]
930-ADB
TACE/ADAM17 [Unconjugated]
(1 Review)
(25 Publications)
Species: Hu
Recombinant Human
TMPRSS13 GST (N-Term) ...
H00084000-Q01
SDS-Page: Recombinant Human TMPRSS13 Protein [H00084000-Q01] - 12.5% SDS-PAGE Stained with Coomassie Blue.
Species: Hu
PSP94/MSMB
Antibody (OTI6C7) - A ...
NBP2-73624
Western Blot: PSP94/MSMB Antibody (OTI6C7) - Azide and BSA Free [NBP2-73624] - Right lane) cDNA for 48 hrs and lysed. Equivalent amounts of cell lysates (5 ug per lane) were separated by SDS-PAGE and immunoblotted with anti-MSMB. Positive lysates
Immunocytochemistry/Immunofluorescence: PSP94/MSMB Antibody (OTI6C7) - Azide and BSA Free [NBP2-73624] - Staining of HeLa cells using anti-mouse monoclonal antibody.
Immunohistochemistry: PSP94/MSMB Antibody (OTI6C7) - Azide and BSA Free [NBP2-73624] - Staining of paraffin-embedded colon tissue using anti-Prostate Secretory Protein/PSP mouse monoclonal antibody.
Species: Hu
Applications: WB, ICC/IF, IHC
MeCP2 Antibody
NB600-1101
Western Blot: MeCP2 Antibody [NB600-1101] - Analysis of HeLa cell extract.
Immunocytochemistry/Immunofluorescence: MeCP2 Antibody [NB600-1101] - Analysis of Methyl CpG Binding Protein 2 (green) showing staining in the nucleus of C2C12 cells (right) compared to a negative control without primary antibody (left).
Immunohistochemistry-Paraffin: MeCP2 Antibody [NB600-1101] - Staining in the nucleus of rat brain tissue (right) compared to a negative control without primary antibody (left).
(4 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
ADAM28 Antibody
NBP2-67246
Immunohistochemistry-Paraffin: ADAM28 Antibody [NBP2-67246] - IHC analysis using the ADAM28 antibody at 1:200 dilution in human stomach. Membrane staining was observed.
Immunocytochemistry/Immunofluorescence: ADAM28 Antibody [NBP2-67246] - U937 cells were fixed for 10 minutes using 10% formalin and then permeabilized for 5 minutes using 1X PBS + 0.05% Triton-X100. The cells were incubated with anti-ADAM28 at 10 ug/ml overnight at 4C and detected with an anti-rabbit Dylight 488 (Green) at a 1:500 dilution. Nuclei were counterstained with DAPI (Blue). Cells were imaged using a 40X objective.
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MSP/MST1
[Unconjugated]
352-MS/CF
MSP/MST1 [Unconjugated]
(8 Publications)
Species: Hu
Invadolysin
Antibody
NBP1-92025
Western Blot: Invadolysin Antibody [NBP1-92025] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/Immunofluorescence: Invadolysin Antibody [NBP1-92025] - Immunofluorescent staining of human cell line A-431 shows localization to cytosol & focal adhesion sites. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: Invadolysin Antibody [NBP1-92025] - Staining of human testis shows cytoplasmic positivity in cells in seminiferous ducts.
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
DNMT1 Antibody
(60B1220.1)
NB100-56519
Western Blot: DNMT1 Antibody (60B1220.1) [NB100-56519] - Analysis of Dnmt1 in 2102EP (human embryonic carcinoma) in the A) absence and B) presence of immunizing peptide, recombinant human Dnmt1 protein in the C) absence and D) presence of immunizing peptide, NIH 3T3 (mouse embryonic fribroblast) in the E) absence and F) presence of immunizing peptide, and D3 (mouse embryonic stem cell) in the G) absence and H) presence of immunizing peptide using Dnmt1 antibody. this antibody. 5 ug/ml for testing the human cell line and 0.1 ug/ml was used for testing the recombinant protein and the mouse cell lines. ’s goat anti-mouse Ig HRP secondary antibody and PicoTect ECL substrate solution were used for this test.
Immunocytochemistry/Immunofluorescence: DNMT1 Antibody (60B1220.1) [NB100-56519] - Dnmt1 antibody was tested in HeLa cells with Dylight 488 (green). Nuclei and alpha-tubulin were counterstained with DAPI (blue) and DyLight 550 (red). Antibody dilution of 1:10 was used. Image objective 40x.
Immunohistochemistry-Paraffin: DNMT1 Antibody (60B1220.1) [NB100-56519] - Tissue section of human hepatocellular carcinoma at 1:50 dilution.
(4 Reviews)
(119 Publications)
Species: Hu, Mu, Rt, Po, Bv, Sh
Applications: WB, Simple Western, ChIP, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC, IHC-FrFl, KD
KLF7 Antibody
NBP1-80638
Immunocytochemistry/Immunofluorescence: KLF7 Antibody [NBP1-80638] - Staining of human cell line U-251 MG shows localization to the Golgi apparatus. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: KLF7 Antibody [NBP1-80638] - Staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: KLF7 Antibody [NBP1-80638] - Staining of human duodenum shows moderate to strong nuclear positivity in glandular cells.
Species: Hu
Applications: ICC/IF, IHC, IHC-P
MAP2 Antibody
NB300-213
Immunocytochemistry/Immunofluorescence: MAP2 Antibody [NB300-213] - Mouse primary cultures stained with MAP2 antibody. Image from verified customer review.
Immunocytochemistry/Immunofluorescence: MAP2 Antibody [NB300-213] - Immunofluorescent analysis of cortical neuron-glial cell culture from E20 rat stained with chicken pAb to microtubule associated protein 2 (MAP2), NB300-213, dilution 1:10,000 in red, and mouse mAb to MAP-tau, NPB2-25162, dilution 1:2,000, in green. The blue is DAPI staining of nuclear DNA. NB300-213 antibody stains dendrites and perikarya of neurons, while NBP2-25162 antibody labels neuronal perikarya, dendrites and also axonal process. As a result perikarya and dendrites appears orange-yellow, since they contain both MAP2 and tau, while axons are green.
Western Blot: MAP2 Antibody [NB300-213] - Western blot analysis of whole brain tissue lysates using chicken pAb to microtubule associated protein 2 (MAP2), NB300-213, dilution 1:50,000 in green: [1] protein standard (red), [2] adult rat brain, [3] embryonic E20 rat brain, [4] adult mouse brain. Strong band observed at ~280kDa mark corresponds to two major isoforms of MAP2 protein referred to as MAP2A and MAP2B. Smaller fragments of these isoforms are also detected if the antibody is used at higher concentrations.
(4 Reviews)
(56 Publications)
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, KD

Publications for ADAM23 Antibody (NBP1-81250)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: IHC, WB.


Filter By Application
IHC
(1)
WB
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for ADAM23 Antibody (NBP1-81250) (0)

There are no reviews for ADAM23 Antibody (NBP1-81250). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADAM23 Antibody (NBP1-81250) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Learn about Custom Antibody Labeling

Additional ADAM23 Products

Bioinformatics Tool for ADAM23 Antibody (NBP1-81250)

Discover related pathways, diseases and genes to ADAM23 Antibody (NBP1-81250). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADAM23 Antibody (NBP1-81250)

Discover more about diseases related to ADAM23 Antibody (NBP1-81250).
 

Pathways for ADAM23 Antibody (NBP1-81250)

View related products by pathway.

PTMs for ADAM23 Antibody (NBP1-81250)

Learn more about PTMs related to ADAM23 Antibody (NBP1-81250).

Blogs on ADAM23

There are no specific blogs for ADAM23, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

  SDS
  PDF Datasheet
  Request CofA

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADAM23 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol ADAM23
Entrez
Uniprot