ADA2a Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: ADA2a Antibody [NBP2-57507] - Staining of human cell line SH-SY5Y shows localization to nuclear speckles.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ADA2a Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MDRLGPFSNDPSDKPPCRGCSSYLMEPYIKCAECGPPPFFLCLQCFTRGFEYKKHQSDHTYEIMTSD
Specificity
Specificity of human ADA2a antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (97%), Rat (99%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TADA2A
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
ADA2a Recombinant Protein Antigen (NBP2-57507PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for ADA2a Antibody

  • ADA2AFLJ12705
  • ADA2-like protein
  • hADA2
  • TADA2LADA2
  • transcriptional adapter 2-alpha
  • Transcriptional adapter 2-like
  • transcriptional adaptor 2 (ADA2 homolog, yeast)-like
  • transcriptional adaptor 2 alpha
  • transcriptional adaptor 2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-56629
Species: Hu
Applications: WB
NBP1-90243
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB2695
Species: Hu
Applications: WB
H00093624-M08
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P
NBP2-12933
Species: Hu, Mu, Rt, Po
Applications: WB, PEP-ELISA
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP1-89238
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP2-61879
Species: Hu, Mu
Applications: WB, ELISA, Flow, IHC
NBP2-07996
Species: Hu
NBP2-52487
Species: Hu
Applications: WB, ELISA, Flow, IHC, CyTOF-ready, ICC, IF
NBP2-45466
Species: Hu
Applications: WB, IHC
NB200-310
Species: Hu, Mu, Rt, Mk
Applications: WB, ChIP, IP, IF
NB100-1756
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NBP2-58076
Species: Hu
Applications: ICC/IF
NB100-58824
Species: Hu, Mu
Applications: WB, ChIP, IP, CHIP-SEQ
AF1227
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC
NBP2-57507
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for ADA2a Antibody (NBP2-57507) (0)

There are no publications for ADA2a Antibody (NBP2-57507).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADA2a Antibody (NBP2-57507) (0)

There are no reviews for ADA2a Antibody (NBP2-57507). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for ADA2a Antibody (NBP2-57507) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Array Products

Bioinformatics Tool for ADA2a Antibody (NBP2-57507)

Discover related pathways, diseases and genes to ADA2a Antibody (NBP2-57507). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ADA2a Antibody (NBP2-57507)

Discover more about diseases related to ADA2a Antibody (NBP2-57507).
 

Pathways for ADA2a Antibody (NBP2-57507)

View related products by pathway.

PTMs for ADA2a Antibody (NBP2-57507)

Learn more about PTMs related to ADA2a Antibody (NBP2-57507).
 

Research Areas for ADA2a Antibody (NBP2-57507)

Find related products by research area.

Blogs on ADA2a

There are no specific blogs for ADA2a, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ADA2a Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TADA2A