Recombinant Human ADA2 beta Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human ADA2 beta Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 2 - 110 of Human MGC21874 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:AELGKKYCVYCLAEVSPLRFRCTECQDIELCPECFSAGAEIGHHRRYHGYQLVDGGRFTLWGPEAEGGWTSREEQLLLDAIEQFGFGNWEDMAAHVGASRTPQEVMEHY

Details of Functionality
This protein is not active and should not be used for experiments requiring activity.
Protein/Peptide Type
Partial Recombinant Protein
Gene
TADA2B
Purity
>80%, by SDS-PAGE

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Purity
>80%, by SDS-PAGE

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human ADA2 beta Protein

  • ADA2-beta
  • ADA2-like protein beta
  • MGC21874
  • transcriptional adapter 2-beta
  • transcriptional adaptor 2 (ADA2 homolog, yeast)-beta
  • transcriptional adaptor 2B

Background

MGC21874 - transcriptional adaptor 2 (ADA2 homolog, yeast)-beta

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-57507
Species: Hu
Applications: ICC/IF
NBP2-17017
Species: Hu, Mu
Applications: WB, ICC/IF
NBP1-89238
Species: Hu
Applications: WB, Simple Western, IHC, IHC-P
NBP1-90243
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IF
H00010153-B01P
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NB500-171
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
NBP1-85351
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF3487
Species: Hu
Applications: WB, IHC, ICC
NBP2-07996
Species: Hu
NBP1-90058
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-52486
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
AF4079
Species: Hu
Applications: WB, ICC
H00008850-M04
Species: Hu
Applications: WB, ELISA, ICC/IF
AF7365
Species: Hu, Mu, Rt
Applications: WB
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NB100-2594
Species: Hu, Mu
Applications: WB, ChIP, IHC-P, IP, PLA
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP2-22786
Species: Hu
NBP1-87744
Species: Hu
Applications: WB, IHC, IHC-P

Publications for ADA2 beta Partial Recombinant Protein (H00093624-Q01) (0)

There are no publications for ADA2 beta Partial Recombinant Protein (H00093624-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ADA2 beta Partial Recombinant Protein (H00093624-Q01) (0)

There are no reviews for ADA2 beta Partial Recombinant Protein (H00093624-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ADA2 beta Partial Recombinant Protein (H00093624-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ADA2 beta Products

Bioinformatics Tool for ADA2 beta Partial Recombinant Protein (H00093624-Q01)

Discover related pathways, diseases and genes to ADA2 beta Partial Recombinant Protein (H00093624-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ADA2 beta Partial Recombinant Protein (H00093624-Q01)

View related products by pathway.

PTMs for ADA2 beta Partial Recombinant Protein (H00093624-Q01)

Learn more about PTMs related to ADA2 beta Partial Recombinant Protein (H00093624-Q01).

Blogs on ADA2 beta

There are no specific blogs for ADA2 beta, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human ADA2 beta Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol TADA2B