ACTRT2 Antibody

Images

 
Western Blot: ACTRT2 Antibody [NBP1-54626] - Human Muscle lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACTRT2 Antibody Summary

Immunogen
Synthetic peptides corresponding to ACTRT2(actin-related protein T2) The peptide sequence was selected from the C terminal of ACTRT2. Peptide sequence LDDRLLKELEQLASKDTPIKITAPPDRWFSTWIGASIVTSLSSFKQMWVT.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACTRT2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against ACTRT2 and was validated on Western blot.
Theoretical MW
42 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACTRT2 Antibody

  • actin-related protein hArpM2
  • Actin-related protein M2
  • actin-related protein T2
  • ARPM2HARPM2
  • ARPT2
  • Arp-T2
  • FLJ25424

Background

ACTRT2 belongs to the actin family. Studies have shown that this protein may be involved in cytoskeletal organization similar to other cytoplasmic actin-related protein (ARP) subfamily members. Antibody raised against the human protein has been used to detect the protein by immunoblotting and immunofluorescence microscopy, demonstrating its specific synthesis in the testis, late in spermatid differentiation, and its localization in the calyx.The protein encoded by this intronless gene belongs to the actin family. Studies have shown that this protein may be involved in cytoskeletal organization similar to other cytoplasmic actin-related protein (ARP) subfamily members. Antibody raised against the human protein has been used to detect the protein by immunoblotting and immunofluorescence microscopy, demonstrating its specific synthesis in the testis, late in spermatid differentiation, and its localization in the calyx.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34951
Species: Hu
H00057016-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-90910
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-88838
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00010097-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P
MAB4675
Species: Mu
Applications: WB, IHC, Neut
NBP2-14306
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-53182
Species: Hu
Applications: WB
NBP2-15278
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-91988
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-56428
Species: Hu
Applications: ICC/IF, IHC-P
NBP1-54626
Species: Hu
Applications: WB

Publications for ACTRT2 Antibody (NBP1-54626) (0)

There are no publications for ACTRT2 Antibody (NBP1-54626).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACTRT2 Antibody (NBP1-54626) (0)

There are no reviews for ACTRT2 Antibody (NBP1-54626). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACTRT2 Antibody (NBP1-54626) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACTRT2 Products

Bioinformatics Tool for ACTRT2 Antibody (NBP1-54626)

Discover related pathways, diseases and genes to ACTRT2 Antibody (NBP1-54626). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on ACTRT2

There are no specific blogs for ACTRT2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACTRT2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTRT2
Uniprot