ACTRT1 Antibody

Images

 
Western Blot: ACTRT1 Antibody [NBP1-56370] - Human Pancrease lysate, concentration 0.2-1 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACTRT1 Antibody Summary

Immunogen
Synthetic peptides corresponding to ACTRT1(actin-related protein T1) The peptide sequence was selected from the middle region of ACTRT1. Peptide sequence DTDIQNKLYADIVLSGGTTLLPGLEERLMKEVEQLASKGTPIKITASPDR. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACTRT1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against ACTRT1 and was validated on Western blot.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for ACTRT1 Antibody

  • actin-related protein T1
  • AIP1
  • ARIP1
  • Arp-T1
  • ARPT1HSD27
  • KIAA0705
  • MGC26590

Background

The specific function of ACTRT1 is not yet known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-90201
Species: Hu
Applications: ICC/IF, IHC, IHC-P, KD, WB
NBP2-94061
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, IP, WB
NBP2-00527
Species: Ca, Hu, Pm, Mu, Pm
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP1-33177
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-32665
Species: Hu
Applications: IHC, IHC-P, WB
AF7117
Species: Hu, Mu
Applications: ICC, IHC, WB
NBP2-52983
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-67481
Species: Hu, Mu
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NB200-112
Species: Ca, Ha, Hu, Pm, Mu, Po, Pm, Rt
Applications: EM, ELISA, Flow, ICC/IF, IHC-FrFl, IHC, IHC-P, IP, KD, WB
NBP1-85614
Species: Hu, Mu
Applications: IHC, IHC-P, WB
H00027183-P01
Species: Hu
Applications: ELISA, AP, PA, WB
H00010097-M01
Species: Hu
Applications: ELISA, IHC, IHC-P, S-ELISA, WB
NBP1-30081
Species: Hu, Mu
Applications: IP, WB
NBP3-06005
Species: Hu
Applications: IHC, IHC-P, IP, WB
NB200-103
Species: Hu, Mu, Rt, Xp(-), Ye
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, WB
NBP2-67514
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
NBP1-91988
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
NBP2-37574
Species: Hu, Mu, Rt
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
NB100-56173
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB

Publications for ACTRT1 Antibody (NBP1-56370) (0)

There are no publications for ACTRT1 Antibody (NBP1-56370).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACTRT1 Antibody (NBP1-56370) (0)

There are no reviews for ACTRT1 Antibody (NBP1-56370). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACTRT1 Antibody (NBP1-56370) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACTRT1 Products

Bioinformatics Tool for ACTRT1 Antibody (NBP1-56370)

Discover related pathways, diseases and genes to ACTRT1 Antibody (NBP1-56370). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for ACTRT1 Antibody (NBP1-56370)

View related products by pathway.

Blogs on ACTRT1

There are no specific blogs for ACTRT1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACTRT1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTRT1
Uniprot