ACTR8 Antibody

Images

 
Western Blot: ACTR8 Antibody [NBP2-82551] - Host: Rabbit. Target Name: ACTR8. Sample Type: Jurkat Whole Cell lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACTR8 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human ACTR8. Peptide sequence: MTQAEKGDTENGKEKGGEKEKEQRGVKRPIVPALVPESLQEQIQSNFIIV The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
ACTR8
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACTR8 Antibody

  • Actin-Related Protein 8
  • ARP8 (Actin-Related Protein 8, Yeast) Homolog
  • ARP8 Actin-Related Protein 8 Homolog
  • ARP8
  • HArp8
  • INO80 Complex Subunit N
  • INO80N

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-78758
Species: Hu
Applications: IP, WB (-)
NBP2-92520
Species: Hu, Mu, Rt
Applications: WB
AF3485
Species: Hu, Pm
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), WB
NB100-61628
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, IP (-), Simple Western, WB
NBP2-82073
Species: Hu
Applications: ELISA, ICC/IF, IHC, IHC-P, WB
AF2288
Species: Hu
Applications: ICC, IHC, Simple Western, WB
NBP1-00131
Species: Hu
Applications: Flow, PEP-ELISA, WB
MAB7527
Species: Mu
Applications: ICC, WB
NBP1-31341
Species: Hu, Pm, Mu, Rt
Applications: ELISA, ICC/IF, IHC, IHC-P, KO, S-ELISA, WB
NBP2-20932
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NBP1-85351
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
NB100-56346
Species: Hu, Mu, Sh
Applications: ELISA, Flow, IHC, IHC-P, WB
NBP1-84063
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-14306
Species: Hu
Applications: IHC, IHC-P, WB
NBP2-58116
Species: Hu
Applications: ICC/IF, KD, WB
NB100-148
Species: Ce, Ch, Hu, Mu, Rt
Applications: ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, PLA, WB
NBP2-07996
Species: Hu
Applications: WB
NBP2-82551
Species: Hu
Applications: WB

Publications for ACTR8 Antibody (NBP2-82551) (0)

There are no publications for ACTR8 Antibody (NBP2-82551).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACTR8 Antibody (NBP2-82551) (0)

There are no reviews for ACTR8 Antibody (NBP2-82551). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACTR8 Antibody (NBP2-82551) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional ACTR8 Products

Array NBP2-82551

Bioinformatics Tool for ACTR8 Antibody (NBP2-82551)

Discover related pathways, diseases and genes to ACTR8 Antibody (NBP2-82551). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACTR8 Antibody (NBP2-82551)

Discover more about diseases related to ACTR8 Antibody (NBP2-82551).
 

Pathways for ACTR8 Antibody (NBP2-82551)

View related products by pathway.

PTMs for ACTR8 Antibody (NBP2-82551)

Learn more about PTMs related to ACTR8 Antibody (NBP2-82551).

Blogs on ACTR8

There are no specific blogs for ACTR8, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACTR8 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTR8