ACTL7A Antibody

Images

 
Immunohistochemistry: ACTL7A Antibody [NBP1-86014] - Immunohistochemical staining of human testis shows distinct positivity.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACTL7A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKRAVWVRHTSSEPQEPTESKAAKERPKQEVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGK
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACTL7A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACTL7A Protein (NBP1-86014PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACTL7A Antibody

  • actin-like 7A
  • actin-like 7-alpha
  • actin-like protein 7A
  • actin-like-7-alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86973
Species: Hu
Applications: WB, IHC, IHC-P
NB100-74413
Species: Hu, Mu, Rb
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-00932
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
AF3158
Species: Mu
Applications: WB, ChIP, ICC
NBP2-45514
Species: Hu
Applications: WB, IHC
NBP1-32858
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P, IP
MAB3000
Species: Hu, Mu, Rt
Applications: WB
NBP1-33341
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-25147
Species: Hu, Mu, Rt, Bv, Xp
Applications: WB, Simple Western, ICC/IF
AF2340
Species: Hu
Applications: WB, Flow, IP, CyTOF-ready
NBP1-57929
Species: Hu
Applications: WB
NBP1-86014
Species: Hu
Applications: IHC, IHC-P

Publications for ACTL7A Antibody (NBP1-86014) (0)

There are no publications for ACTL7A Antibody (NBP1-86014).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACTL7A Antibody (NBP1-86014) (0)

There are no reviews for ACTL7A Antibody (NBP1-86014). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

FAQs for ACTL7A Antibody (NBP1-86014) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACTL7A Products

Bioinformatics Tool for ACTL7A Antibody (NBP1-86014)

Discover related pathways, diseases and genes to ACTL7A Antibody (NBP1-86014). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACTL7A Antibody (NBP1-86014)

Discover more about diseases related to ACTL7A Antibody (NBP1-86014).

Research Areas for ACTL7A Antibody (NBP1-86014)

Find related products by research area.

Blogs on ACTL7A

There are no specific blogs for ACTL7A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACTL7A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTL7A