![Immunohistochemistry-Paraffin: ACTL7A Antibody [NBP1-86014] - Analysis in human testis and skeletal muscle tissues using NBP1-86014 antibody. Corresponding ACTL7A RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/ACTL7A-Antibody-Immunohistochemistry-Paraffin-NBP1-86014-img0009.jpg "Immunohistochemistry-Paraffin: ACTL7A Antibody [NBP1-86014] - Analysis in human testis and skeletal muscle tissues using NBP1-86014 antibody. Corresponding ACTL7A RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Description | Novus Biologicals Rabbit ACTL7A Antibody - BSA Free (NBP1-86014) is a polyclonal antibody validated for use in IHC. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MWAPPAAIMGDGPTKKVGNQAPLQTQALQTASLRDGPAKRAVWVRHTSSEPQEPTESKAAKERPKQEVTKAVVVDLGTGYCKCGFAGLPRPTHKISTTVGK |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | ACTL7A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
Research Areas for ACTL7A Antibody (NBP1-86014)Find related products by research area.
|
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | ACTL7A |
![Immunohistochemistry-Paraffin: ACTL7A Antibody [NBP1-86014] - Staining of human skin shows no positivity in squamous epithelial cells as expected.](http://images.novusbio.com/fullsize/ACTL7A-Antibody-Immunohistochemistry-Paraffin-NBP1-86014-img0006.jpg "Immunohistochemistry-Paraffin: ACTL7A Antibody [NBP1-86014] - Staining of human skin shows no positivity in squamous epithelial cells as expected.")
![Immunohistochemistry-Paraffin: ACTL7A Antibody [NBP1-86014] - Staining of human testis shows strong positivity in acrosomes in cells in seminiferous ducts.](http://images.novusbio.com/fullsize/ACTL7A-Antibody-Immunohistochemistry-Paraffin-NBP1-86014-img0007.jpg "Immunohistochemistry-Paraffin: ACTL7A Antibody [NBP1-86014] - Staining of human testis shows strong positivity in acrosomes in cells in seminiferous ducts.")
![Immunohistochemistry-Paraffin: ACTL7A Antibody [NBP1-86014] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.](http://images.novusbio.com/fullsize/ACTL7A-Antibody-Immunohistochemistry-Paraffin-NBP1-86014-img0008.jpg "Immunohistochemistry-Paraffin: ACTL7A Antibody [NBP1-86014] - Staining of human tonsil shows no positivity in non-germinal center cells as expected.")
![Chromatin Immunoprecipitation (ChIP) KLF4 Antibody [Unconjugated]](https://images.novusbio.com/images2/KLF4_AF3158_Chromatin_Immunoprecipitation_11234.jpg)
![Immunocytochemistry KLF4 Antibody [Unconjugated]](https://images.novusbio.com/images2/KLF4_AF3158_Immunocytochemistry_7262.jpg)
![Immunohistochemistry KLF4 Antibody [Unconjugated]](https://images.novusbio.com/images2/KLF4_AF3158_Immunohistochemistry_24135.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")