ACTL7B Antibody

Images

 
Western Blot: ACTL7B Antibody [NBP1-86973] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: ACTL7B Antibody [NBP1-86973] - Staining of human testis shows strong nuclear and cytoplasmic positivity in cells of seminiferous ducts.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACTL7B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MATRNSPMPLGTAQGDPGEAGTRPGPDASLRDTGAATQLKMKPRKVHKIKAVIIDLGSQYCKCGYAGEPRPTYFISSTVGKRCPEAADAGDTRKWTL
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ACTL7B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ACTL7B Protein (NBP1-86973PEP)
Publications
Read Publications using
NBP1-86973 in the following applications:

  • IHC
    1 publication
  • WB
    1 publication

Reactivity Notes

Reactivity reported in scientific literature (PMID: 23920108)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ACTL7B Antibody

  • actin-like 7B
  • actin-like 7-beta
  • actin-like protein 7B
  • actin-like-7-beta
  • Tact1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-86014
Species: Hu
Applications: IHC, IHC-P
H00000072-D01P
Species: Hu
Applications: WB
NBP1-33341
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
MAB7265
Species: Mu
Applications: WB, IHC

Publications for ACTL7B Antibody (NBP1-86973)(3)

Reviews for ACTL7B Antibody (NBP1-86973) (0)

There are no reviews for ACTL7B Antibody (NBP1-86973). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACTL7B Antibody (NBP1-86973) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACTL7B Products

Bioinformatics Tool for ACTL7B Antibody (NBP1-86973)

Discover related pathways, diseases and genes to ACTL7B Antibody (NBP1-86973). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACTL7B Antibody (NBP1-86973)

Discover more about diseases related to ACTL7B Antibody (NBP1-86973).
 

Pathways for ACTL7B Antibody (NBP1-86973)

View related products by pathway.

PTMs for ACTL7B Antibody (NBP1-86973)

Learn more about PTMs related to ACTL7B Antibody (NBP1-86973).
 

Research Areas for ACTL7B Antibody (NBP1-86973)

Find related products by research area.

Blogs on ACTL7B

There are no specific blogs for ACTL7B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACTL7B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ACTL7B