ACCN4 Recombinant Protein Antigen

Images

 
There are currently no images for ACCN4 Recombinant Protein Antigen (NBP3-17796PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ACCN4 Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ACCN4

Source: E. coli

Amino Acid Sequence: GLLAREGQGREALASPSSRGQMPIEIVCKIKFAEEDAKPKEKEAGDEQSLLGAVAPGAAPRDLATFASTSTLH

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
ASIC4
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10-100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP3-17796.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ACCN4 Recombinant Protein Antigen

  • Acid-sensing ion channel 4
  • amiloride-sensitive cation channel 4, pituitaryMGC17248
  • ASIC4MGC24860
  • BNAC4amiloride-sensitive cation channel 4
  • brain sodium channel 4

Background

ACCN4 belongs to the superfamily of acid-sensing ion channels, which are proton-gated, amiloride-sensitive sodium channels. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. ACCN4 is predominantly expressed in the pituitary gland, and might be a candidate for paroxysmal dystonic choreoathetosis (PDC), a movement disorder. FUNCTION: Probable cation channel with high affinity for sodium. These channels have been implicated in synaptic transmission, pain perception as well as mechanoperception. SUBUNIT: Homotetramer or heterotetramer with other ASIC proteins (Probable). SUBCELLULAR LOCATION: Membrane; Multi-pass membrane protein. TISSUE SPECIFICITY: This gene is predominantly expressed in the pituitary gland. Expressed in brain, spinal chord and dorsal root ganglion (DRG). Expressed by a subset of sensory neurons in the DRG. Expressed by granule cells in the cerebellar cortex. In hippocampus, expression is detected in dentate gyrus granule cells, in pyramidal cells of CA1-CA3 subfields and in interneurons of the striatum oriens and radiatum of all subfields. In cerebral cortex expressed in small, medium and large pyramidal cells in layers 2, 3 and 5 respectively. Also expressed in striatum, globus pallidus, inferior and superior calliculi, amygdala, magnocellular preoptic nucleus, islands of Calleja and large neurons of olfactory tubercules. DEVELOPMENTAL STAGE: Highly expressed in newborn spinal chord but hardly detected in the cerebellum compared to adult. Expressed at postnatal day 1 in ependymal cells lining the central canal of spinal chord and in motor neurons. In adult, expression decreases in ependymal cells and increases in motor neurons. The number of positive interneurons decreases but the individual interneuron expression increases in adult spinal chord compared to newborn. MISCELLANEOUS: In vitro, has no proton-gated channel activity.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-22409
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, WB
NBP1-46288
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-14321
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-56566
Species: Bv, Hu, Ma, Mu, Po, Rt
Applications: B/N, ChIP, CyTOF-ready, DB, Dual ISH-IHC, ELISA(Cap), ELISA, Flow-CS, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, In vitro, KD, KO, PAGE, Simple Western, WB
NB100-56565
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr,  IHC-P, Simple Western, WB
AF1375
Species: Hu
Applications: WB
NBP2-56179
Species: Hu
Applications: ICC/IF
H00003748-M01
Species: Hu, Mu, Rb
Applications: ELISA, ICC/IF, WB
H00008767-M02
Species: Hu, Mu, Rt
Applications: ELISA, IHC,  IHC-P, WB
NBP1-53125
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-91968
Species: Hu
Applications: ICC/IF, IHC,  IHC-P
AF808
Species: Mu
Applications: ELISA(Cap), ELISA(Det), ELISA(Sta), ICC, IHC, Neut, WB
NBP3-17796PEP
Species: Hu
Applications: AC

Publications for ACCN4 Recombinant Protein Antigen (NBP3-17796PEP) (0)

There are no publications for ACCN4 Recombinant Protein Antigen (NBP3-17796PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACCN4 Recombinant Protein Antigen (NBP3-17796PEP) (0)

There are no reviews for ACCN4 Recombinant Protein Antigen (NBP3-17796PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ACCN4 Recombinant Protein Antigen (NBP3-17796PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ACCN4 Products

Research Areas for ACCN4 Recombinant Protein Antigen (NBP3-17796PEP)

Find related products by research area.

Blogs on ACCN4

There are no specific blogs for ACCN4, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ACCN4 Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol ASIC4