ACBP Recombinant Protein Antigen

Images

 
There are currently no images for ACBP Protein (NBP2-38648PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

ACBP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human DBI.

Source: E. coli

Amino Acid Sequence: MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
DBI
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38648.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
22 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for ACBP Recombinant Protein Antigen

  • ACBP
  • acyl-Coenzyme A binding domain containing 1
  • acyl-Coenzyme A bindingprotein)
  • CCK-RP
  • cholecystokinin-releasing peptide, trypsin-sensitive
  • DBI
  • diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)
  • Diazepam-binding inhibitor
  • Endozepine
  • EP
  • GABA receptor modulator
  • MGC70414

Background

ACBP encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. ACBP is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NLS3890
Species: Bv, Hu, Pm, Pm
Applications: IHC,  IHC-P
MEP00B
Species: Mu
Applications: ELISA
NLS975
Species: Bt, Hu, Pm, Pm
Applications: IHC,  IHC-P
NBP3-16740
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-89522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-689
Species: Hu, Rt
Applications: IHC, IHC-Fr,  IHC-P, Simple Western, WB
NB100-1533
Species: Hu, Mu, Po, Rt, Sh
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
M6000B
Species: Mu
Applications: ELISA
NLS1049
Species: Eq, Hu, Pm, Po, Pm
Applications: ICC, ICC/IF, IHC,  IHC-P
H00005729-B01P
Species: Hu
Applications: Flow, ICC/IF, WB
NBP3-13522
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NB100-41398
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, PEP-ELISA, WB
MAB9080
Species: Hu
Applications: WB
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
AF3398
Species: Hu, Mu, Rt
Applications: ICC, KO, Simple Western, WB

Publications for ACBP Protein (NBP2-38648PEP) (0)

There are no publications for ACBP Protein (NBP2-38648PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACBP Protein (NBP2-38648PEP) (0)

There are no reviews for ACBP Protein (NBP2-38648PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for ACBP Protein (NBP2-38648PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional ACBP Products

Research Areas for ACBP Protein (NBP2-38648PEP)

Find related products by research area.

Blogs on ACBP

There are no specific blogs for ACBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our ACBP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol DBI