ACBP Antibody

Images

 
Western Blot: ACBP Antibody [H00001622-D01P] - Analysis of DBI expression in transfected 293T cell line by DBI polyclonal antibody.Lane 1: DBI transfected lysate(11.80 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ACBP Antibody Summary

Immunogen
DBI (NP_065438.1, 1 a.a. - 104 a.a.) full-length human protein. MWGDLWLLPPASANPGTGTEAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDFTGKAKWDAWNELKGTSKEDAMKAYINKVEELKKKYGI
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
DBI
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for ACBP Antibody

  • acyl-Coenzyme A binding domain containing 1
  • acyl-Coenzyme A bindingprotein)
  • CCK-RP
  • cholecystokinin-releasing peptide, trypsin-sensitive
  • diazepam binding inhibitor (GABA receptor modulator, acyl-CoA binding protein)
  • Diazepam-binding inhibitor
  • endozepine
  • EP
  • GABA receptor modulator
  • MGC70414

Background

This gene encodes diazepam binding inhibitor, a protein that is regulated by hormones and is involved in lipid metabolism and the displacement of beta-carbolines and benzodiazepines, which modulate signal transduction at type A gamma-aminobutyric acid receptors located in brain synapses. The protein is conserved from yeast to mammals, with the most highly conserved domain consisting of seven contiguous residues that constitute the hydrophobic binding site for medium- and long-chain acyl-Coenzyme A esters. Diazepam binding inhibitor is also known to mediate the feedback regulation of pancreatic secretion and the postprandial release of cholecystokinin, in addition to its role as a mediator in corticotropin-dependent adrenal steroidogenesis. Three pseudogenes located on chromosomes 6, 8 and 16 have been identified. Multiple transcript variants encoding different isoforms have been described for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84833
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-84835
Species: Hu
Applications: WB, IHC, IHC-P
MAB6656
Species: Hu
Applications: WB, IHC
NBP1-89522
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NB100-689
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
NB100-1533
Species: Hu, Mu, Po, Sh
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NLS1049
Species: Hu, Eq, Mk, Pm
Applications: IHC-P, ICC
NBP1-71688
Species: Hu, Mu, Po
Applications: WB, Simple Western, ICC/IF
NB100-41398
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, PEP-ELISA
NBP1-49879
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP1-32421
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-24916
Species: Hu, Mu, Rt, Bv
Applications: WB, IHC, IHC-P

Publications for ACBP Antibody (H00001622-D01P) (0)

There are no publications for ACBP Antibody (H00001622-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ACBP Antibody (H00001622-D01P) (0)

There are no reviews for ACBP Antibody (H00001622-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ACBP Antibody (H00001622-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ACBP Products

Bioinformatics Tool for ACBP Antibody (H00001622-D01P)

Discover related pathways, diseases and genes to ACBP Antibody (H00001622-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ACBP Antibody (H00001622-D01P)

Discover more about diseases related to ACBP Antibody (H00001622-D01P).
 

Pathways for ACBP Antibody (H00001622-D01P)

View related products by pathway.

PTMs for ACBP Antibody (H00001622-D01P)

Learn more about PTMs related to ACBP Antibody (H00001622-D01P).
 

Research Areas for ACBP Antibody (H00001622-D01P)

Find related products by research area.

Blogs on ACBP

There are no specific blogs for ACBP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ACBP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol DBI
Uniprot