ABI3 Antibody - BSA Free

Western Blot: ABI3 Antibody [NBP2-82553] - Host: Rabbit. Target Name: Abi3. Sample Type: Mouse Heart lysates. Antibody Dilution: 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

ABI3 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ABI3 Antibody - BSA Free (NBP2-82553) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Abi3. Peptide sequence: DEPSWVPASYLEKVVTLYPYTRQKDNELSFSEGTVICVTRRYSDGWCEGV The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABI3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for ABI3 Antibody - BSA Free

• ABI family, member 3
• ABI gene family member 3
• Nesh
• NESHABI gene family, member 3
• New molecule including SH3
• SSH3BP3

Background

The ABI3 gene encodes a member of an adaptor protein family. Members of this family encode proteins containing a homeobox homology domain, proline rich region and Src-homology 3 (SH3) domain. The encoded protein inhibits ectopic metastasis of tumor cells as w

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABI3