ABHD14B Antibody - BSA Free

Western Blot: ABHD14B Antibody [NBP1-84473] - Analysis in control (vector only transfected HEK293T lysate) and ABHD14B over-expression lysate (Co-expressed with a C-terminal myc-DDK tag (3.1 kDa) in mammalian HEK293T cells).

Staining of human liver shows moderate cytoplasmic positivity in hepatocytes.

Staining of human colon shows moderate cytoplasmic positivity in glandular cells.

Staining of human kidney shows moderate cytoplasmic positivity in cells in tubules.

Staining of human testis shows moderate cytoplasmic positivity in Leydig cells.

• Reactivity: Hu
• Applications: WB, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

ABHD14B Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit ABHD14B Antibody - BSA Free (NBP1-84473) is a polyclonal antibody validated for use in IHC and WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: ABHD14B
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:20 - 1:50
  • Immunohistochemistry-Paraffin 1:20 - 1:50
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended.
• Control Peptide:

  ABHD14B Protein (NBP1-84473PEP)

Reactivity Notes

Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (83%)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for ABHD14B Antibody - BSA Free

• abhydrolase domain containing 14B
• abhydrolase domain-containing protein 14B
• CCG1-interacting factor B
• CIBcell cycle gene 1-interacting factor B
• EC 3.-
• EC 3.1.11.6
• EC 3.1.21.4
• MGC15429

Background

ABHD14B has hydrolase activity towards p-nitrophenyl butyrate (in vitro). May activate transcription

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: ABHD14B