ABHD14B Antibody

Images

 
Western Blot: ABHD14B Antibody [NBP1-84473] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Negative control (vector only transfected HEK293T lysate). Lane 3: Over-expression lysate (Co-expressed ...read more
Immunohistochemistry-Paraffin: ABHD14B Antibody [NBP1-84473] - Staining of human placenta shows strong cytoplasmic and membranous positivity in trophoblastic cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

ABHD14B Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:MAASVEQREGTIQVQGQALFFREALPGSGQARFSVLLLHGIRFSSETWQNLGTLHRLAQAGYRAV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
ABHD14B
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
ABHD14B Protein (NBP1-84473PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (83%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for ABHD14B Antibody

  • abhydrolase domain containing 14B
  • abhydrolase domain-containing protein 14B
  • CCG1-interacting factor B
  • CIBcell cycle gene 1-interacting factor B
  • EC 3.-
  • EC 3.1.11.6
  • EC 3.1.21.4
  • MGC15429

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB7557
Species: Hu
Applications: WB, IHC
NBP2-32530
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB120-2860
Species: Hu, Mu, Rt, Ba, Bv, Ch
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, ICC, IF
NBP1-98474
Species: Hu
Applications: WB
NBP2-15078
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP2-37384
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P
NBP2-45923
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00005957-M37
Species: Hu
Applications: WB, ELISA, ICC/IF
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
H00000341-M01
Species: Hu
Applications: WB, ELISA
NBP2-14934
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-547
Species: Hu
Applications: WB, ICC/IF, IP, PLA
NBP1-92684
Species: Hu, Mu, Rt, Po, Bv
Applications: WB, ICC/IF
NBP2-21584
Species: Hu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NB100-314
Species: Hu
Applications: WB, IP, PLA
NBP1-87404
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-83049
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for ABHD14B Antibody (NBP1-84473) (0)

There are no publications for ABHD14B Antibody (NBP1-84473).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for ABHD14B Antibody (NBP1-84473) (0)

There are no reviews for ABHD14B Antibody (NBP1-84473). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for ABHD14B Antibody (NBP1-84473) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional ABHD14B Products

Bioinformatics Tool for ABHD14B Antibody (NBP1-84473)

Discover related pathways, diseases and genes to ABHD14B Antibody (NBP1-84473). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for ABHD14B Antibody (NBP1-84473)

Discover more about diseases related to ABHD14B Antibody (NBP1-84473).
 

Pathways for ABHD14B Antibody (NBP1-84473)

View related products by pathway.

Blogs on ABHD14B

There are no specific blogs for ABHD14B, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our ABHD14B Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol ABHD14B